BLASTX nr result
ID: Coptis23_contig00029820
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00029820 (497 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276313.1| PREDICTED: transcription-repair-coupling fac... 103 2e-20 gb|AAN72199.1| putative helicase [Arabidopsis thaliana] 102 2e-20 ref|NP_566160.1| putative DEAD/DEAH box helicase [Arabidopsis th... 102 2e-20 gb|AAK43897.1|AF370520_1 putative helicase [Arabidopsis thaliana] 102 2e-20 ref|NP_001078092.1| putative DEAD/DEAH box helicase [Arabidopsis... 102 2e-20 >ref|XP_002276313.1| PREDICTED: transcription-repair-coupling factor-like [Vitis vinifera] Length = 823 Score = 103 bits (256), Expect = 2e-20 Identities = 58/108 (53%), Positives = 69/108 (63%) Frame = +2 Query: 170 KRIESTSDDDITLLNERIRRDLSKREGASRNTLNSEEAEKYIXXXXXXXXXXXXXXXGDR 349 +R+E SDD IT+LNERIRR+ SKR+ + ++SEEA+KYI G+R Sbjct: 67 ERMEPESDD-ITILNERIRREQSKRDVSRAPVVDSEEADKYIQLVKEQQRRGLQKLKGER 125 Query: 350 TXXXXXXXXXXTFSYKVDPYTLHSGDYVVHKKVGVGRFVGIKFDVSKD 493 FSYKVDPYTL SGDYVVHKKVG+GRFVGIK DV KD Sbjct: 126 VGKENGQ-----FSYKVDPYTLRSGDYVVHKKVGIGRFVGIKLDVPKD 168 >gb|AAN72199.1| putative helicase [Arabidopsis thaliana] Length = 822 Score = 102 bits (255), Expect = 2e-20 Identities = 60/105 (57%), Positives = 65/105 (61%) Frame = +2 Query: 179 ESTSDDDITLLNERIRRDLSKREGASRNTLNSEEAEKYIXXXXXXXXXXXXXXXGDRTXX 358 E D I+LLNERIRRDL KRE A R ++SEEAEKYI G R Sbjct: 66 ELAESDSISLLNERIRRDLGKRETA-RPAMDSEEAEKYIHMVKEQQERGLQKLKGIRQGT 124 Query: 359 XXXXXXXXTFSYKVDPYTLHSGDYVVHKKVGVGRFVGIKFDVSKD 493 FSYKVDPY+L SGDYVVHKKVG+GRFVGIKFDV KD Sbjct: 125 KAAGDG--AFSYKVDPYSLLSGDYVVHKKVGIGRFVGIKFDVPKD 167 >ref|NP_566160.1| putative DEAD/DEAH box helicase [Arabidopsis thaliana] gi|332640233|gb|AEE73754.1| putative DEAD/DEAH box helicase [Arabidopsis thaliana] Length = 823 Score = 102 bits (255), Expect = 2e-20 Identities = 60/105 (57%), Positives = 65/105 (61%) Frame = +2 Query: 179 ESTSDDDITLLNERIRRDLSKREGASRNTLNSEEAEKYIXXXXXXXXXXXXXXXGDRTXX 358 E D I+LLNERIRRDL KRE A R ++SEEAEKYI G R Sbjct: 67 ELAESDSISLLNERIRRDLGKRETA-RPAMDSEEAEKYIHMVKEQQERGLQKLKGIRQGT 125 Query: 359 XXXXXXXXTFSYKVDPYTLHSGDYVVHKKVGVGRFVGIKFDVSKD 493 FSYKVDPY+L SGDYVVHKKVG+GRFVGIKFDV KD Sbjct: 126 KAAGDG--AFSYKVDPYSLLSGDYVVHKKVGIGRFVGIKFDVPKD 168 >gb|AAK43897.1|AF370520_1 putative helicase [Arabidopsis thaliana] Length = 823 Score = 102 bits (255), Expect = 2e-20 Identities = 60/105 (57%), Positives = 65/105 (61%) Frame = +2 Query: 179 ESTSDDDITLLNERIRRDLSKREGASRNTLNSEEAEKYIXXXXXXXXXXXXXXXGDRTXX 358 E D I+LLNERIRRDL KRE A R ++SEEAEKYI G R Sbjct: 67 ELAESDSISLLNERIRRDLGKRETA-RPAMDSEEAEKYIHMVKEQQERGLQKLKGIRQGT 125 Query: 359 XXXXXXXXTFSYKVDPYTLHSGDYVVHKKVGVGRFVGIKFDVSKD 493 FSYKVDPY+L SGDYVVHKKVG+GRFVGIKFDV KD Sbjct: 126 KAAGDG--AFSYKVDPYSLLSGDYVVHKKVGIGRFVGIKFDVPKD 168 >ref|NP_001078092.1| putative DEAD/DEAH box helicase [Arabidopsis thaliana] gi|6513947|gb|AAF14851.1|AC011664_33 putative helicase [Arabidopsis thaliana] gi|332640234|gb|AEE73755.1| putative DEAD/DEAH box helicase [Arabidopsis thaliana] Length = 822 Score = 102 bits (255), Expect = 2e-20 Identities = 60/105 (57%), Positives = 65/105 (61%) Frame = +2 Query: 179 ESTSDDDITLLNERIRRDLSKREGASRNTLNSEEAEKYIXXXXXXXXXXXXXXXGDRTXX 358 E D I+LLNERIRRDL KRE A R ++SEEAEKYI G R Sbjct: 66 ELAESDSISLLNERIRRDLGKRETA-RPAMDSEEAEKYIHMVKEQQERGLQKLKGIRQGT 124 Query: 359 XXXXXXXXTFSYKVDPYTLHSGDYVVHKKVGVGRFVGIKFDVSKD 493 FSYKVDPY+L SGDYVVHKKVG+GRFVGIKFDV KD Sbjct: 125 KAAGDG--AFSYKVDPYSLLSGDYVVHKKVGIGRFVGIKFDVPKD 167