BLASTX nr result
ID: Coptis23_contig00029700
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00029700 (321 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004173856.1| PREDICTED: putative ribonuclease H protein A... 55 8e-06 >ref|XP_004173856.1| PREDICTED: putative ribonuclease H protein At1g65750-like [Cucumis sativus] Length = 342 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/83 (34%), Positives = 41/83 (49%) Frame = +2 Query: 68 QDQVVWTPHSRGQFTSHSAYQALSPVKDKKKWQKLVWGKWVLPRHSFTT**LFSQSLPTQ 247 +D+ VW P SR F+ SA++ + P + W L+WG +P+HSF L T+ Sbjct: 168 EDRWVWVPGSRDSFSITSAWETIRPHSSRVGWSGLLWGGGNIPKHSFCAWLAIRDRLSTR 227 Query: 248 DRLVQRKILQSSTCCSLCNNNWE 316 DRL R C LC N+E Sbjct: 228 DRL-SRWDRSIPLSCLLCGGNYE 249