BLASTX nr result
ID: Coptis23_contig00029693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00029693 (207 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_199695.1| pantoate--beta-alanine ligase [Arabidopsis thal... 57 2e-06 gb|AAM62758.1| pantoate-beta-alanine ligase [Arabidopsis thaliana] 57 2e-06 ref|XP_002865683.1| pantoate-beta-alanine ligase [Arabidopsis ly... 56 3e-06 emb|CBI37277.3| unnamed protein product [Vitis vinifera] 56 3e-06 ref|XP_002266330.1| PREDICTED: pantoate--beta-alanine ligase-lik... 56 3e-06 >ref|NP_199695.1| pantoate--beta-alanine ligase [Arabidopsis thaliana] gi|20139170|sp|Q9FKB3.1|PANC_ARATH RecName: Full=Pantoate--beta-alanine ligase; AltName: Full=Pantoate-activating enzyme; AltName: Full=Pantothenate synthetase gi|9758883|dbj|BAB09437.1| pantoate-beta-alanine ligase [Arabidopsis thaliana] gi|51968618|dbj|BAD43001.1| pantoate-beta-alanine ligase [Arabidopsis thaliana] gi|332008349|gb|AED95732.1| pantoate--beta-alanine ligase [Arabidopsis thaliana] Length = 310 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -1 Query: 93 EIITEKDKMRKWSRSMRAKGKTIGLVPTMGY 1 E+I +KD MRKWSR+MR++GKTIGLVPTMGY Sbjct: 4 EVIRDKDSMRKWSRAMRSQGKTIGLVPTMGY 34 >gb|AAM62758.1| pantoate-beta-alanine ligase [Arabidopsis thaliana] Length = 310 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -1 Query: 93 EIITEKDKMRKWSRSMRAKGKTIGLVPTMGY 1 E+I +KD MRKWSR+MR++GKTIGLVPTMGY Sbjct: 4 EVIRDKDSMRKWSRAMRSQGKTIGLVPTMGY 34 >ref|XP_002865683.1| pantoate-beta-alanine ligase [Arabidopsis lyrata subsp. lyrata] gi|297311518|gb|EFH41942.1| pantoate-beta-alanine ligase [Arabidopsis lyrata subsp. lyrata] Length = 310 Score = 56.2 bits (134), Expect = 3e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -1 Query: 93 EIITEKDKMRKWSRSMRAKGKTIGLVPTMGY 1 E+I +KD MRKWSR+MR +GKTIGLVPTMGY Sbjct: 4 EVIRDKDSMRKWSRAMRLQGKTIGLVPTMGY 34 >emb|CBI37277.3| unnamed protein product [Vitis vinifera] Length = 287 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -1 Query: 93 EIITEKDKMRKWSRSMRAKGKTIGLVPTMGY 1 EII +KD+MR+WSR MR++GKTIGLVPTMGY Sbjct: 10 EIIRDKDEMRRWSRRMRSQGKTIGLVPTMGY 40 >ref|XP_002266330.1| PREDICTED: pantoate--beta-alanine ligase-like [Vitis vinifera] Length = 315 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = -1 Query: 93 EIITEKDKMRKWSRSMRAKGKTIGLVPTMGY 1 EII +KD+MR+WSR MR++GKTIGLVPTMGY Sbjct: 7 EIIRDKDEMRRWSRRMRSQGKTIGLVPTMGY 37