BLASTX nr result
ID: Coptis23_contig00029551
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00029551 (363 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004136455.1| PREDICTED: G-type lectin S-receptor-like ser... 56 3e-06 ref|XP_004173422.1| PREDICTED: G-type lectin S-receptor-like ser... 55 6e-06 >ref|XP_004136455.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5-like [Cucumis sativus] Length = 363 Score = 56.2 bits (134), Expect = 3e-06 Identities = 23/44 (52%), Positives = 33/44 (75%) Frame = +2 Query: 230 VATRKPLQFSHGQIIRYTSNLETPIGSGGFGKVYKGKLPDGVEV 361 +A KP++F+ Q+ +TSN T +GSGGFG+VYKGK P+GV + Sbjct: 8 IAEEKPVRFTADQLYTFTSNYSTRLGSGGFGEVYKGKFPNGVNI 51 >ref|XP_004173422.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300-like [Cucumis sativus] Length = 358 Score = 55.1 bits (131), Expect = 6e-06 Identities = 22/44 (50%), Positives = 34/44 (77%) Frame = +2 Query: 230 VATRKPLQFSHGQIIRYTSNLETPIGSGGFGKVYKGKLPDGVEV 361 +A +P++F+ Q+ +TSN TP+GSGGFG VYKG+ P+GV++ Sbjct: 8 MAEERPVRFTPQQLYCFTSNYSTPLGSGGFGSVYKGQFPNGVKI 51