BLASTX nr result
ID: Coptis23_contig00029327
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00029327 (792 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002971529.1| hypothetical protein SELMODRAFT_71198 [Selag... 57 5e-06 ref|XP_002991605.1| hypothetical protein SELMODRAFT_3003 [Selagi... 57 5e-06 >ref|XP_002971529.1| hypothetical protein SELMODRAFT_71198 [Selaginella moellendorffii] gi|300160661|gb|EFJ27278.1| hypothetical protein SELMODRAFT_71198 [Selaginella moellendorffii] Length = 220 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/44 (54%), Positives = 32/44 (72%) Frame = +1 Query: 394 DGDRIPVLIAGYGVDKGIEYWLIKTSNGEQCGENGYMRVEKGTN 525 D R+ VLI GYG +KG +YW+IK S G GENGYMR+++G + Sbjct: 159 DKPRLAVLIVGYGSEKGEDYWIIKNSWGTSWGENGYMRIQRGNH 202 >ref|XP_002991605.1| hypothetical protein SELMODRAFT_3003 [Selaginella moellendorffii] gi|300140638|gb|EFJ07359.1| hypothetical protein SELMODRAFT_3003 [Selaginella moellendorffii] Length = 220 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/44 (54%), Positives = 32/44 (72%) Frame = +1 Query: 394 DGDRIPVLIAGYGVDKGIEYWLIKTSNGEQCGENGYMRVEKGTN 525 D R+ VLI GYG +KG +YW+IK S G GENGYMR+++G + Sbjct: 159 DKPRLAVLIVGYGSEKGEDYWIIKNSWGTSWGENGYMRIQRGNH 202