BLASTX nr result
ID: Coptis23_contig00029253
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00029253 (672 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002276359.2| PREDICTED: anoctamin-7-like [Vitis vinifera]... 64 2e-08 ref|XP_003533021.1| PREDICTED: anoctamin-8-like [Glycine max] 60 4e-07 ref|XP_003529740.1| PREDICTED: anoctamin-8-like [Glycine max] 60 5e-07 ref|XP_002515888.1| conserved hypothetical protein [Ricinus comm... 58 1e-06 ref|XP_002888903.1| hypothetical protein ARALYDRAFT_476432 [Arab... 57 4e-06 >ref|XP_002276359.2| PREDICTED: anoctamin-7-like [Vitis vinifera] gi|297743119|emb|CBI35986.3| unnamed protein product [Vitis vinifera] Length = 660 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/35 (85%), Positives = 35/35 (100%) Frame = +1 Query: 568 GLSEEFIKVAAPLETLGRAAAELQIKKPTYIGMDL 672 G+++EFIK+AAPLETLGRAAAELQIKKPT+IGMDL Sbjct: 51 GIADEFIKLAAPLETLGRAAAELQIKKPTHIGMDL 85 >ref|XP_003533021.1| PREDICTED: anoctamin-8-like [Glycine max] Length = 803 Score = 60.1 bits (144), Expect = 4e-07 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 568 GLSEEFIKVAAPLETLGRAAAELQIKKPTYIGMDL 672 G+++EFIK+AAPLETLGRAAAELQIKK T IGMDL Sbjct: 196 GIADEFIKLAAPLETLGRAAAELQIKKQTLIGMDL 230 >ref|XP_003529740.1| PREDICTED: anoctamin-8-like [Glycine max] Length = 658 Score = 59.7 bits (143), Expect = 5e-07 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +1 Query: 568 GLSEEFIKVAAPLETLGRAAAELQIKKPTYIGMDL 672 G+++EFIK+AAPLETLGRAAAELQIKK T IGMDL Sbjct: 51 GIADEFIKLAAPLETLGRAAAELQIKKRTLIGMDL 85 >ref|XP_002515888.1| conserved hypothetical protein [Ricinus communis] gi|223544793|gb|EEF46308.1| conserved hypothetical protein [Ricinus communis] Length = 655 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/35 (80%), Positives = 33/35 (94%) Frame = +1 Query: 568 GLSEEFIKVAAPLETLGRAAAELQIKKPTYIGMDL 672 GL++EFIK+AAPL TLG+AAAELQ+KK TYIGMDL Sbjct: 55 GLTDEFIKLAAPLVTLGKAAAELQMKKLTYIGMDL 89 >ref|XP_002888903.1| hypothetical protein ARALYDRAFT_476432 [Arabidopsis lyrata subsp. lyrata] gi|297334744|gb|EFH65162.1| hypothetical protein ARALYDRAFT_476432 [Arabidopsis lyrata subsp. lyrata] Length = 667 Score = 56.6 bits (135), Expect = 4e-06 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = +1 Query: 568 GLSEEFIKVAAPLETLGRAAAELQIKKPTYIGMDL 672 GL++EF+KVAAPLETLG AAAEL I+KPT +G+DL Sbjct: 49 GLADEFLKVAAPLETLGNAAAELHIRKPTRLGIDL 83