BLASTX nr result
ID: Coptis23_contig00029147
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00029147 (250 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002882292.1| ku70-binding family protein [Arabidopsis lyr... 87 1e-15 ref|NP_566205.1| ku70-binding-like protein [Arabidopsis thaliana... 87 1e-15 ref|XP_002526954.1| protein with unknown function [Ricinus commu... 86 2e-15 ref|XP_002269112.1| PREDICTED: mitochondrial inner membrane prot... 86 3e-15 ref|XP_002448069.1| hypothetical protein SORBIDRAFT_06g020460 [S... 85 5e-15 >ref|XP_002882292.1| ku70-binding family protein [Arabidopsis lyrata subsp. lyrata] gi|297328132|gb|EFH58551.1| ku70-binding family protein [Arabidopsis lyrata subsp. lyrata] Length = 195 Score = 87.4 bits (215), Expect = 1e-15 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -1 Query: 250 EQECVRRRVLESLKGNPNCSEAAAKDATDAVWDVCYNDTKPFDRAP 113 EQEC++RRVL+SL+GNP CSE AAKDA +AVWD CYNDTKPFDRAP Sbjct: 150 EQECIKRRVLKSLRGNPYCSEVAAKDAMEAVWDTCYNDTKPFDRAP 195 >ref|NP_566205.1| ku70-binding-like protein [Arabidopsis thaliana] gi|6017109|gb|AAF01592.1|AC009895_13 hypothetical protein [Arabidopsis thaliana] gi|13877935|gb|AAK44045.1|AF370230_1 unknown protein [Arabidopsis thaliana] gi|16323466|gb|AAL15227.1| unknown protein [Arabidopsis thaliana] gi|332640421|gb|AEE73942.1| ku70-binding-like protein [Arabidopsis thaliana] Length = 194 Score = 87.4 bits (215), Expect = 1e-15 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -1 Query: 250 EQECVRRRVLESLKGNPNCSEAAAKDATDAVWDVCYNDTKPFDRAP 113 EQEC++RRVL+SL+GNP CSE AAKDA +AVWD CYNDTKPFDRAP Sbjct: 149 EQECIKRRVLKSLRGNPYCSEVAAKDAMEAVWDTCYNDTKPFDRAP 194 >ref|XP_002526954.1| protein with unknown function [Ricinus communis] gi|223533706|gb|EEF35441.1| protein with unknown function [Ricinus communis] Length = 187 Score = 86.3 bits (212), Expect = 2e-15 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = -1 Query: 250 EQECVRRRVLESLKGNPNCSEAAAKDATDAVWDVCYNDTKPFDRAP 113 EQECVRRRV++S+ NP CSEAAAKDA +AVWDVCYNDTKPFDRAP Sbjct: 142 EQECVRRRVMKSMIANPYCSEAAAKDAMEAVWDVCYNDTKPFDRAP 187 >ref|XP_002269112.1| PREDICTED: mitochondrial inner membrane protease ATP23 [Vitis vinifera] gi|296081332|emb|CBI17714.3| unnamed protein product [Vitis vinifera] Length = 195 Score = 85.9 bits (211), Expect = 3e-15 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = -1 Query: 247 QECVRRRVLESLKGNPNCSEAAAKDATDAVWDVCYNDTKPFDRAP 113 QECVRRRV++S+ NP+CSEAAAKDA +AVWDVCYNDTKPFDRAP Sbjct: 151 QECVRRRVMKSVTANPHCSEAAAKDAMEAVWDVCYNDTKPFDRAP 195 >ref|XP_002448069.1| hypothetical protein SORBIDRAFT_06g020460 [Sorghum bicolor] gi|241939252|gb|EES12397.1| hypothetical protein SORBIDRAFT_06g020460 [Sorghum bicolor] Length = 207 Score = 85.1 bits (209), Expect = 5e-15 Identities = 37/46 (80%), Positives = 41/46 (89%) Frame = -1 Query: 250 EQECVRRRVLESLKGNPNCSEAAAKDATDAVWDVCYNDTKPFDRAP 113 EQECV+RR L SLK NP CSEAAAKDA +AVWD+CYNDT+PFDRAP Sbjct: 162 EQECVKRRALLSLKSNPYCSEAAAKDAMEAVWDICYNDTRPFDRAP 207