BLASTX nr result
ID: Coptis23_contig00029060
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00029060 (289 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK40590.1| unknown [Lotus japonicus] 77 1e-12 ref|NP_567098.2| FKBP-type peptidyl-prolyl cis-trans isomerase 6... 77 2e-12 ref|XP_002878331.1| immunophilin [Arabidopsis lyrata subsp. lyra... 77 2e-12 dbj|BAH57219.1| AT3G60370 [Arabidopsis thaliana] 77 2e-12 ref|NP_001236089.1| uncharacterized protein LOC100305486 [Glycin... 73 3e-11 >gb|AFK40590.1| unknown [Lotus japonicus] Length = 246 Score = 77.4 bits (189), Expect = 1e-12 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -1 Query: 289 PPAGPSTFFSSKQFEVFDVELLNIQNCERIIILAFYSDVVCS 164 PP GPSTFFS+KQFEVFDVELL IQNCER +LAFYSDVVC+ Sbjct: 205 PPVGPSTFFSAKQFEVFDVELLGIQNCERRTVLAFYSDVVCN 246 >ref|NP_567098.2| FKBP-type peptidyl-prolyl cis-trans isomerase 6 [Arabidopsis thaliana] gi|122236257|sp|Q0WRJ7.1|FK202_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP20-2, chloroplastic; Short=PPIase FKBP20-2; AltName: Full=FK506-binding protein 20-2; Short=AtFKBP20-2; AltName: Full=Immunophilin FKBP20-2; AltName: Full=Rotamase; Flags: Precursor gi|110736573|dbj|BAF00252.1| hypothetical protein [Arabidopsis thaliana] gi|119360117|gb|ABL66787.1| At3g60370 [Arabidopsis thaliana] gi|332646531|gb|AEE80052.1| FKBP-type peptidyl-prolyl cis-trans isomerase 6 [Arabidopsis thaliana] Length = 242 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -1 Query: 289 PPAGPSTFFSSKQFEVFDVELLNIQNCERIIILAFYSDVVCS 164 PP GPSTFFSSKQFEVFDVELL+IQNCER I+ FYSDV CS Sbjct: 201 PPVGPSTFFSSKQFEVFDVELLSIQNCERRTIIGFYSDVTCS 242 >ref|XP_002878331.1| immunophilin [Arabidopsis lyrata subsp. lyrata] gi|297324169|gb|EFH54590.1| immunophilin [Arabidopsis lyrata subsp. lyrata] Length = 244 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -1 Query: 289 PPAGPSTFFSSKQFEVFDVELLNIQNCERIIILAFYSDVVCS 164 PP GPSTFFSSKQFEVFDVELL+IQNCER I+ FYSDV CS Sbjct: 203 PPVGPSTFFSSKQFEVFDVELLSIQNCERRTIIGFYSDVTCS 244 >dbj|BAH57219.1| AT3G60370 [Arabidopsis thaliana] Length = 74 Score = 76.6 bits (187), Expect = 2e-12 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -1 Query: 289 PPAGPSTFFSSKQFEVFDVELLNIQNCERIIILAFYSDVVCS 164 PP GPSTFFSSKQFEVFDVELL+IQNCER I+ FYSDV CS Sbjct: 33 PPVGPSTFFSSKQFEVFDVELLSIQNCERRTIIGFYSDVTCS 74 >ref|NP_001236089.1| uncharacterized protein LOC100305486 [Glycine max] gi|255625657|gb|ACU13173.1| unknown [Glycine max] Length = 248 Score = 72.8 bits (177), Expect = 3e-11 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = -1 Query: 289 PPAGPSTFFSSKQFEVFDVELLNIQNCERIIILAFYSDVVCS 164 PP GPSTFFSSKQFEVFDVELL++QNCER I AFYSDVVC+ Sbjct: 208 PPVGPSTFFSSKQFEVFDVELLSVQNCERRTI-AFYSDVVCN 248