BLASTX nr result
ID: Coptis23_contig00029041
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00029041 (269 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002530990.1| WRKY transcription factor, putative [Ricinus... 115 5e-24 ref|XP_002323509.1| predicted protein [Populus trichocarpa] gi|2... 114 1e-23 gb|AEK12776.1| WRKY32 [(Populus tomentosa x P. bolleana) x P. to... 113 2e-23 ref|XP_003530211.1| PREDICTED: probable WRKY transcription facto... 112 3e-23 gb|AER70302.1| WRKY transcription factor [(Populus tomentosa x P... 110 9e-23 >ref|XP_002530990.1| WRKY transcription factor, putative [Ricinus communis] gi|223529442|gb|EEF31402.1| WRKY transcription factor, putative [Ricinus communis] Length = 296 Score = 115 bits (287), Expect = 5e-24 Identities = 52/77 (67%), Positives = 63/77 (81%) Frame = -3 Query: 267 SIKNSPHPRSYYRCTNPRCSAKKQVERSSQDSDTLVITYEGLHLHFTYTNFLLNQPQLIQ 88 SIKNSP PRSYYRCTNPRCSAKKQVERSS+D DTLVITYEGLHLHF Y FL++Q ++ Sbjct: 129 SIKNSPFPRSYYRCTNPRCSAKKQVERSSEDQDTLVITYEGLHLHFAYPYFLVDQANHLK 188 Query: 87 PPTKRSKTNINQVQDRQ 37 PP K+ K + ++ ++ Q Sbjct: 189 PPLKKPKKSTSKAEETQ 205 >ref|XP_002323509.1| predicted protein [Populus trichocarpa] gi|222868139|gb|EEF05270.1| predicted protein [Populus trichocarpa] Length = 309 Score = 114 bits (284), Expect = 1e-23 Identities = 52/72 (72%), Positives = 60/72 (83%) Frame = -3 Query: 267 SIKNSPHPRSYYRCTNPRCSAKKQVERSSQDSDTLVITYEGLHLHFTYTNFLLNQPQLIQ 88 SIKNS HPRSYYRCTN RC AKKQVERSS+D DTLVITYEGLHLHF++ FL NQPQ + Sbjct: 130 SIKNSTHPRSYYRCTNRRCGAKKQVERSSEDPDTLVITYEGLHLHFSHPYFLSNQPQHVD 189 Query: 87 PPTKRSKTNINQ 52 PP+K+ K I++ Sbjct: 190 PPSKKPKRTISE 201 >gb|AEK12776.1| WRKY32 [(Populus tomentosa x P. bolleana) x P. tomentosa] Length = 306 Score = 113 bits (282), Expect = 2e-23 Identities = 53/74 (71%), Positives = 60/74 (81%) Frame = -3 Query: 267 SIKNSPHPRSYYRCTNPRCSAKKQVERSSQDSDTLVITYEGLHLHFTYTNFLLNQPQLIQ 88 SIKNSPHPRSYY CTNPRCSAKKQVER S+D DTLVITYEGLHLHFT+ FL NQ Q Sbjct: 127 SIKNSPHPRSYYGCTNPRCSAKKQVERCSEDPDTLVITYEGLHLHFTHPFFLSNQTQHGD 186 Query: 87 PPTKRSKTNINQVQ 46 PP+K+ K I++ + Sbjct: 187 PPSKKPKGTISEAE 200 >ref|XP_003530211.1| PREDICTED: probable WRKY transcription factor 49-like [Glycine max] Length = 307 Score = 112 bits (280), Expect = 3e-23 Identities = 54/78 (69%), Positives = 61/78 (78%), Gaps = 2/78 (2%) Frame = -3 Query: 267 SIKNSPHPRSYYRCTNPRCSAKKQVERSSQDSDTLVITYEGLHLHFTYTNFLLNQPQLIQ 88 SIKNSP+PRSYYRCTNPRCSAKKQVERS++D DTL+ITYEGLHLHF Y FL+ Q Q Sbjct: 129 SIKNSPNPRSYYRCTNPRCSAKKQVERSNEDPDTLIITYEGLHLHFAYPYFLMGQQQQSH 188 Query: 87 --PPTKRSKTNINQVQDR 40 PP K+SK Q QD+ Sbjct: 189 SYPPIKKSKPTSPQAQDQ 206 >gb|AER70302.1| WRKY transcription factor [(Populus tomentosa x P. bolleana) x P. tomentosa] Length = 294 Score = 110 bits (276), Expect = 9e-23 Identities = 50/72 (69%), Positives = 58/72 (80%) Frame = -3 Query: 267 SIKNSPHPRSYYRCTNPRCSAKKQVERSSQDSDTLVITYEGLHLHFTYTNFLLNQPQLIQ 88 SIKNS HPRSYY+CTNPRC AKKQVERS +D DTLVITYEGLHL F++ FL NQPQ Sbjct: 115 SIKNSTHPRSYYKCTNPRCGAKKQVERSGEDPDTLVITYEGLHLRFSHPFFLSNQPQYFD 174 Query: 87 PPTKRSKTNINQ 52 PP+K+ K I++ Sbjct: 175 PPSKKPKRTISE 186