BLASTX nr result
ID: Coptis23_contig00029016
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00029016 (273 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCA66054.1| hypothetical protein [Beta vulgaris subsp. vulga... 56 3e-06 >emb|CCA66054.1| hypothetical protein [Beta vulgaris subsp. vulgaris] Length = 1355 Score = 55.8 bits (133), Expect = 3e-06 Identities = 30/92 (32%), Positives = 47/92 (51%), Gaps = 2/92 (2%) Frame = -3 Query: 271 ANQAEAMELMDTIGQFSAITSETINFENFGVHFSANMPYSDKQFIRRILGITIISSSNKY 92 AN+ E ++D + Q+ + + IN+E V +S + S K + IL + + KY Sbjct: 695 ANRQECTIIVDILNQYELASGQKINYEKSEVSYSRGVSVSQKDELTNILNMRQVDRHEKY 754 Query: 91 LGCPLF--ETKMEMLDSLISKIKGLIQGWKSK 2 LG P +K + DSLI +I +QGWK K Sbjct: 755 LGIPSISGRSKKAIFDSLIDRIWKKLQGWKEK 786