BLASTX nr result
ID: Coptis23_contig00028767
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00028767 (326 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279505.2| PREDICTED: chloroplastic group IIA intron sp... 55 5e-06 emb|CBI27903.3| unnamed protein product [Vitis vinifera] 55 5e-06 >ref|XP_002279505.2| PREDICTED: chloroplastic group IIA intron splicing facilitator CRS1, chloroplastic-like [Vitis vinifera] Length = 884 Score = 55.5 bits (132), Expect = 5e-06 Identities = 22/37 (59%), Positives = 30/37 (81%) Frame = +2 Query: 212 KRVKKKQKLRPNFYEQVREKWSVKLESQRKKFPWQVQ 322 K K K+K RP+F+EQ+R+KWS+K+ S R+KFPWQ Q Sbjct: 52 KTTKAKRKPRPSFFEQIRDKWSLKINSPREKFPWQEQ 88 >emb|CBI27903.3| unnamed protein product [Vitis vinifera] Length = 881 Score = 55.5 bits (132), Expect = 5e-06 Identities = 22/37 (59%), Positives = 30/37 (81%) Frame = +2 Query: 212 KRVKKKQKLRPNFYEQVREKWSVKLESQRKKFPWQVQ 322 K K K+K RP+F+EQ+R+KWS+K+ S R+KFPWQ Q Sbjct: 94 KTTKAKRKPRPSFFEQIRDKWSLKINSPREKFPWQEQ 130