BLASTX nr result
ID: Coptis23_contig00028639
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00028639 (365 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273893.1| PREDICTED: pentatricopeptide repeat-containi... 96 3e-18 ref|XP_002881503.1| pentatricopeptide repeat-containing protein ... 86 4e-15 ref|NP_181268.1| pentatricopeptide repeat-containing protein [Ar... 86 4e-15 ref|XP_002525211.1| pentatricopeptide repeat-containing protein,... 82 4e-14 ref|XP_003541398.1| PREDICTED: pentatricopeptide repeat-containi... 82 6e-14 >ref|XP_002273893.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37310-like [Vitis vinifera] Length = 667 Score = 95.9 bits (237), Expect = 3e-18 Identities = 50/82 (60%), Positives = 60/82 (73%) Frame = -1 Query: 365 YSQAGRWEEAEKVREKMKNMGLKKAPGCSWIETSGGVVSFIAGNGSNPMMEEIFVVLEIL 186 YSQAGRWEEAE +REKMK +GLKK PG SWIETSGG+ SFIA + S+ EEI+ +LE L Sbjct: 586 YSQAGRWEEAENIREKMKKIGLKKIPGTSWIETSGGLRSFIARDVSSERSEEIYGMLEGL 645 Query: 185 VQMMGKESYVGIVELDEESVCI 120 + +M +E Y ELDEE I Sbjct: 646 LGLMREEGYTLQDELDEECAYI 667 >ref|XP_002881503.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297327342|gb|EFH57762.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 669 Score = 85.5 bits (210), Expect = 4e-15 Identities = 42/77 (54%), Positives = 56/77 (72%) Frame = -1 Query: 365 YSQAGRWEEAEKVREKMKNMGLKKAPGCSWIETSGGVVSFIAGNGSNPMMEEIFVVLEIL 186 Y+QAGRWEEAE VR+KMK +GLKK PG SWIET+ G+ SFIA + S +E++ ++E L Sbjct: 579 YTQAGRWEEAEVVRDKMKRIGLKKIPGTSWIETNKGLRSFIAKDSSCERSKEMYDIIEGL 638 Query: 185 VQMMGKESYVGIVELDE 135 V+ M + Y+ ELDE Sbjct: 639 VESMSDKEYIMKQELDE 655 >ref|NP_181268.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75216848|sp|Q9ZUT5.1|PP191_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g37310 gi|4056485|gb|AAC98051.1| hypothetical protein [Arabidopsis thaliana] gi|110741249|dbj|BAF02175.1| hypothetical protein [Arabidopsis thaliana] gi|330254288|gb|AEC09382.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 657 Score = 85.5 bits (210), Expect = 4e-15 Identities = 42/77 (54%), Positives = 54/77 (70%) Frame = -1 Query: 365 YSQAGRWEEAEKVREKMKNMGLKKAPGCSWIETSGGVVSFIAGNGSNPMMEEIFVVLEIL 186 Y+QAGRWEEAE VR KMK +GLKK PG SWIET G+ SFIA + S +E++ ++E L Sbjct: 579 YTQAGRWEEAEMVRNKMKRIGLKKIPGTSWIETEKGLRSFIAKDSSCERSKEMYEIIEGL 638 Query: 185 VQMMGKESYVGIVELDE 135 V+ M + Y+ ELDE Sbjct: 639 VESMSDKEYIRKQELDE 655 >ref|XP_002525211.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223535508|gb|EEF37177.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 654 Score = 82.0 bits (201), Expect = 4e-14 Identities = 43/80 (53%), Positives = 57/80 (71%) Frame = -1 Query: 365 YSQAGRWEEAEKVREKMKNMGLKKAPGCSWIETSGGVVSFIAGNGSNPMMEEIFVVLEIL 186 YSQAGRW+EA++VRE+M +GL+K PG SWIETS G+ SFIA + +EEI V+L+ L Sbjct: 573 YSQAGRWKEADEVRERMNKVGLQKIPGSSWIETSEGLRSFIATDTCTENVEEIHVILKGL 632 Query: 185 VQMMGKESYVGIVELDEESV 126 + +M E V LDEES+ Sbjct: 633 LGLMRDEGKVLQDMLDEESI 652 >ref|XP_003541398.1| PREDICTED: pentatricopeptide repeat-containing protein At2g37310-like [Glycine max] Length = 667 Score = 81.6 bits (200), Expect = 6e-14 Identities = 42/80 (52%), Positives = 59/80 (73%) Frame = -1 Query: 365 YSQAGRWEEAEKVREKMKNMGLKKAPGCSWIETSGGVVSFIAGNGSNPMMEEIFVVLEIL 186 Y+ AG+WE+A +VRE+MK +GL+K G SWIETSGG++SFIA + SN +EI+ +LE L Sbjct: 586 YAHAGKWEQAGEVRERMKVIGLQKIRGSSWIETSGGLLSFIAKDVSNGRSDEIYALLEGL 645 Query: 185 VQMMGKESYVGIVELDEESV 126 + +M +E V ELD E+V Sbjct: 646 LGLMREEGCVLQEELDYENV 665