BLASTX nr result
ID: Coptis23_contig00028630
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00028630 (223 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527019.1| hypothetical protein RCOM_1310780 [Ricinus c... 69 3e-10 ref|XP_002314843.1| predicted protein [Populus trichocarpa] gi|2... 69 3e-10 ref|XP_003592608.1| Wall-associated kinase [Medicago truncatula]... 68 9e-10 ref|XP_002527017.1| wall-associated kinase, putative [Ricinus co... 68 9e-10 gb|ACJ85050.1| unknown [Medicago truncatula] 68 9e-10 >ref|XP_002527019.1| hypothetical protein RCOM_1310780 [Ricinus communis] gi|223533654|gb|EEF35391.1| hypothetical protein RCOM_1310780 [Ricinus communis] Length = 267 Score = 69.3 bits (168), Expect = 3e-10 Identities = 27/46 (58%), Positives = 31/46 (67%) Frame = -3 Query: 218 IDEFLSKGFHLRWIASKCEECSESGGRCGFDYEMHKFMCFCPDRPH 81 +D L +GF L WIAS C C SGG+CGFD + F CFCPDRPH Sbjct: 206 LDRMLERGFVLNWIASNCSICENSGGKCGFDDATYHFKCFCPDRPH 251 >ref|XP_002314843.1| predicted protein [Populus trichocarpa] gi|222863883|gb|EEF01014.1| predicted protein [Populus trichocarpa] Length = 261 Score = 69.3 bits (168), Expect = 3e-10 Identities = 26/45 (57%), Positives = 31/45 (68%) Frame = -3 Query: 215 DEFLSKGFHLRWIASKCEECSESGGRCGFDYEMHKFMCFCPDRPH 81 + L +GF L W AS C +C ESGG+CGFD + F CFCPDRPH Sbjct: 205 ERMLERGFVLNWTASNCSDCEESGGKCGFDTATYDFKCFCPDRPH 249 >ref|XP_003592608.1| Wall-associated kinase [Medicago truncatula] gi|355481656|gb|AES62859.1| Wall-associated kinase [Medicago truncatula] Length = 292 Score = 67.8 bits (164), Expect = 9e-10 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = -3 Query: 218 IDEFLSKGFHLRWIASKCEECSESGGRCGFDYEMHKFMCFCPDRPH 81 I+E L GF L WIAS C EC+ +GGRCGFD +++ F C+C DR H Sbjct: 207 IEESLRNGFRLNWIASDCNECNSTGGRCGFDKDVYNFKCYCTDRVH 252 >ref|XP_002527017.1| wall-associated kinase, putative [Ricinus communis] gi|223533652|gb|EEF35389.1| wall-associated kinase, putative [Ricinus communis] Length = 673 Score = 67.8 bits (164), Expect = 9e-10 Identities = 26/46 (56%), Positives = 31/46 (67%) Frame = -3 Query: 218 IDEFLSKGFHLRWIASKCEECSESGGRCGFDYEMHKFMCFCPDRPH 81 ++ L +GF L WIAS C C SGG+CGFD + F CFCPDRPH Sbjct: 206 LERMLERGFVLNWIASNCSICENSGGKCGFDDATYHFKCFCPDRPH 251 >gb|ACJ85050.1| unknown [Medicago truncatula] Length = 161 Score = 67.8 bits (164), Expect = 9e-10 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = -3 Query: 218 IDEFLSKGFHLRWIASKCEECSESGGRCGFDYEMHKFMCFCPDRPH 81 I+E L GF L WIAS C EC+ +GGRCGFD +++ F C+C DR H Sbjct: 76 IEESLRNGFRLNWIASDCNECNSTGGRCGFDKDVYNFKCYCTDRVH 121