BLASTX nr result
ID: Coptis23_contig00028545
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00028545 (234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAM36702.1| bHLH transcriptional factor AN1 homolog [Rosa hy... 55 5e-06 emb|CBI32369.3| unnamed protein product [Vitis vinifera] 55 8e-06 ref|XP_002277508.1| PREDICTED: transcription factor TT8 [Vitis v... 55 8e-06 gb|ACC68685.1| bHLH-like DNA binding protein [Vitis vinifera] 55 8e-06 gb|ABY26936.1| putative anthocyanin transcriptional regulator [I... 55 8e-06 >dbj|BAM36702.1| bHLH transcriptional factor AN1 homolog [Rosa hybrid cultivar] Length = 702 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/36 (72%), Positives = 29/36 (80%) Frame = -2 Query: 173 LPGKALTRQHHVWLTSANKTDSKVFSRAILAKVSSV 66 LPGKA TR+ HVWLT AN+ DSK FSRAILAK + V Sbjct: 123 LPGKAYTRRQHVWLTGANEVDSKTFSRAILAKSARV 158 >emb|CBI32369.3| unnamed protein product [Vitis vinifera] Length = 620 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -2 Query: 173 LPGKALTRQHHVWLTSANKTDSKVFSRAILAKVSSV 66 LPGKA ++HH+WL AN+ DSKVFSRAILAK + V Sbjct: 121 LPGKAYAKRHHIWLAGANEVDSKVFSRAILAKSARV 156 >ref|XP_002277508.1| PREDICTED: transcription factor TT8 [Vitis vinifera] Length = 696 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -2 Query: 173 LPGKALTRQHHVWLTSANKTDSKVFSRAILAKVSSV 66 LPGKA ++HH+WL AN+ DSKVFSRAILAK + V Sbjct: 121 LPGKAYAKRHHIWLAGANEVDSKVFSRAILAKSARV 156 >gb|ACC68685.1| bHLH-like DNA binding protein [Vitis vinifera] Length = 701 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -2 Query: 173 LPGKALTRQHHVWLTSANKTDSKVFSRAILAKVSSV 66 LPGKA ++HH+WL AN+ DSKVFSRAILAK + V Sbjct: 121 LPGKAYAKRHHIWLAGANEVDSKVFSRAILAKSARV 156 >gb|ABY26936.1| putative anthocyanin transcriptional regulator [Ipomoea horsfalliae] Length = 672 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -2 Query: 173 LPGKALTRQHHVWLTSANKTDSKVFSRAILAKVSSV 66 LPGKA ++HH+WLT AN+ +SKVFSRAILAK + + Sbjct: 128 LPGKAYAKRHHIWLTGANEVESKVFSRAILAKSARI 163