BLASTX nr result
ID: Coptis23_contig00028479
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00028479 (359 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI24184.3| unnamed protein product [Vitis vinifera] 63 2e-08 ref|XP_002524572.1| hypothetical protein RCOM_1211540 [Ricinus c... 56 3e-06 ref|XP_002321223.1| predicted protein [Populus trichocarpa] gi|2... 55 5e-06 >emb|CBI24184.3| unnamed protein product [Vitis vinifera] Length = 1188 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/54 (48%), Positives = 40/54 (74%) Frame = -3 Query: 264 GNDDFHATSSKRRTPHELEALEDWYSDDRYPSKKAMDDFASSLNLTYKQLRGWF 103 G + + S +R+TP +L+ LE YS+D YP+++ M D+A++L LTYKQ+RGWF Sbjct: 13 GTINTNTNSIRRKTPLQLKTLESLYSEDNYPTQRVMKDYAAALGLTYKQVRGWF 66 >ref|XP_002524572.1| hypothetical protein RCOM_1211540 [Ricinus communis] gi|223536125|gb|EEF37780.1| hypothetical protein RCOM_1211540 [Ricinus communis] Length = 1120 Score = 56.2 bits (134), Expect = 3e-06 Identities = 21/45 (46%), Positives = 37/45 (82%) Frame = -3 Query: 234 KRRTPHELEALEDWYSDDRYPSKKAMDDFASSLNLTYKQLRGWFV 100 KR++P +L+ALE +Y++ +YPS+ M++ A L+LT+KQ++GWF+ Sbjct: 4 KRKSPLQLQALEKFYAEQKYPSQMVMEELAGVLDLTFKQVQGWFI 48 >ref|XP_002321223.1| predicted protein [Populus trichocarpa] gi|222861996|gb|EEE99538.1| predicted protein [Populus trichocarpa] Length = 1152 Score = 55.5 bits (132), Expect = 5e-06 Identities = 24/46 (52%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = -3 Query: 234 KRRTPHELEALEDWYS-DDRYPSKKAMDDFASSLNLTYKQLRGWFV 100 KR++P +L+AL +Y+ +D+YPS++AM+D A NLT+KQ+RGWF+ Sbjct: 2 KRKSPLQLQALLKFYAAEDKYPSQRAMEDLAVVSNLTFKQVRGWFI 47