BLASTX nr result
ID: Coptis23_contig00028389
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00028389 (279 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI31836.3| unnamed protein product [Vitis vinifera] 78 6e-13 ref|XP_002274702.1| PREDICTED: putative dihydrodipicolinate redu... 78 6e-13 ref|XP_003592305.1| Dihydrodipicolinate reductase [Medicago trun... 77 2e-12 ref|XP_003556086.1| PREDICTED: putative dihydrodipicolinate redu... 76 3e-12 ref|XP_003536480.1| PREDICTED: putative dihydrodipicolinate redu... 76 3e-12 >emb|CBI31836.3| unnamed protein product [Vitis vinifera] Length = 303 Score = 78.2 bits (191), Expect = 6e-13 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 39 QVYSLKHDITDVQCLMPGLILAIRRVVRLKNLVYGLEKFL 158 +VYSLKHDITDV+CLMPGLILAIR+VVRLKNLVYGLEKFL Sbjct: 264 EVYSLKHDITDVRCLMPGLILAIRKVVRLKNLVYGLEKFL 303 >ref|XP_002274702.1| PREDICTED: putative dihydrodipicolinate reductase 3, chloroplastic [Vitis vinifera] gi|147816661|emb|CAN68386.1| hypothetical protein VITISV_012454 [Vitis vinifera] Length = 302 Score = 78.2 bits (191), Expect = 6e-13 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = +3 Query: 39 QVYSLKHDITDVQCLMPGLILAIRRVVRLKNLVYGLEKFL 158 +VYSLKHDITDV+CLMPGLILAIR+VVRLKNLVYGLEKFL Sbjct: 263 EVYSLKHDITDVRCLMPGLILAIRKVVRLKNLVYGLEKFL 302 >ref|XP_003592305.1| Dihydrodipicolinate reductase [Medicago truncatula] gi|355481353|gb|AES62556.1| Dihydrodipicolinate reductase [Medicago truncatula] Length = 302 Score = 76.6 bits (187), Expect = 2e-12 Identities = 34/40 (85%), Positives = 40/40 (100%) Frame = +3 Query: 39 QVYSLKHDITDVQCLMPGLILAIRRVVRLKNLVYGLEKFL 158 ++Y++KHDITDVQCLMPGL+LAIR+VVRLKNLVYGLEKFL Sbjct: 263 EIYTIKHDITDVQCLMPGLLLAIRKVVRLKNLVYGLEKFL 302 >ref|XP_003556086.1| PREDICTED: putative dihydrodipicolinate reductase 3, chloroplastic-like [Glycine max] Length = 301 Score = 75.9 bits (185), Expect = 3e-12 Identities = 34/40 (85%), Positives = 40/40 (100%) Frame = +3 Query: 39 QVYSLKHDITDVQCLMPGLILAIRRVVRLKNLVYGLEKFL 158 +VYS+KHDITDV+CLMPGL+LAIR+VVRLKNLVYGLEKF+ Sbjct: 262 EVYSIKHDITDVKCLMPGLLLAIRKVVRLKNLVYGLEKFI 301 >ref|XP_003536480.1| PREDICTED: putative dihydrodipicolinate reductase 3, chloroplastic-like [Glycine max] Length = 301 Score = 75.9 bits (185), Expect = 3e-12 Identities = 34/40 (85%), Positives = 40/40 (100%) Frame = +3 Query: 39 QVYSLKHDITDVQCLMPGLILAIRRVVRLKNLVYGLEKFL 158 +VYS+KHDITDV+CLMPGL+LAIR+VVRLKNLVYGLEKF+ Sbjct: 262 EVYSIKHDITDVKCLMPGLLLAIRKVVRLKNLVYGLEKFI 301