BLASTX nr result
ID: Coptis23_contig00028354
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00028354 (200 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002863281.1| oxidoreductase [Arabidopsis lyrata subsp. ly... 49 4e-09 ref|XP_002537148.1| Quinone oxidoreductase, putative [Ricinus co... 45 6e-09 ref|NP_193037.1| putative quinone-oxidoreductase-like protein [A... 48 7e-09 ref|XP_003634840.1| PREDICTED: putative quinone-oxidoreductase h... 42 2e-08 dbj|BAJ34603.1| unnamed protein product [Thellungiella halophila] 46 3e-08 >ref|XP_002863281.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] gi|297309115|gb|EFH39540.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] Length = 329 Score = 48.9 bits (115), Expect(2) = 4e-09 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = -2 Query: 199 STFEPNLSEYGKVIDITPGPRALMTLLIEEINL 101 STFEPNLSE GKVIDITPGP A+ T ++++ + Sbjct: 235 STFEPNLSENGKVIDITPGPSAMWTYAVKKVTM 267 Score = 36.6 bits (83), Expect(2) = 4e-09 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -3 Query: 117 LKKLTFSKKQVVPVLLSAKAENLE 46 +KK+T SKKQ+VP+LL KAENLE Sbjct: 262 VKKVTMSKKQLVPLLLIPKAENLE 285 >ref|XP_002537148.1| Quinone oxidoreductase, putative [Ricinus communis] gi|223517321|gb|EEF25235.1| Quinone oxidoreductase, putative [Ricinus communis] Length = 230 Score = 44.7 bits (104), Expect(2) = 6e-09 Identities = 20/31 (64%), Positives = 25/31 (80%) Frame = -2 Query: 199 STFEPNLSEYGKVIDITPGPRALMTLLIEEI 107 STFEPNLSE GKVIDITP A+MT ++++ Sbjct: 136 STFEPNLSENGKVIDITPNATAMMTFALKKL 166 Score = 40.4 bits (93), Expect(2) = 6e-09 Identities = 18/26 (69%), Positives = 24/26 (92%) Frame = -3 Query: 123 F*LKKLTFSKKQVVPVLLSAKAENLE 46 F LKKLTFSKKQ+VP++++ KAENL+ Sbjct: 161 FALKKLTFSKKQLVPLIVTVKAENLD 186 >ref|NP_193037.1| putative quinone-oxidoreductase-like protein [Arabidopsis thaliana] gi|67460977|sp|Q9SV68.1|QORH_ARATH RecName: Full=Putative quinone-oxidoreductase homolog, chloroplastic gi|15724256|gb|AAL06521.1|AF412068_1 AT4g13010/F25G13_100 [Arabidopsis thaliana] gi|5123942|emb|CAB45500.1| putative protein [Arabidopsis thaliana] gi|7268003|emb|CAB78343.1| putative protein [Arabidopsis thaliana] gi|15028001|gb|AAK76531.1| unknown protein [Arabidopsis thaliana] gi|15912237|gb|AAL08252.1| AT4g13010/F25G13_100 [Arabidopsis thaliana] gi|21436057|gb|AAM51229.1| unknown protein [Arabidopsis thaliana] gi|332657813|gb|AEE83213.1| putative quinone-oxidoreductase-like protein [Arabidopsis thaliana] Length = 329 Score = 47.8 bits (112), Expect(2) = 7e-09 Identities = 21/33 (63%), Positives = 26/33 (78%) Frame = -2 Query: 199 STFEPNLSEYGKVIDITPGPRALMTLLIEEINL 101 S FEPNLSE GKVIDITPGP A+ T +++I + Sbjct: 235 SVFEPNLSENGKVIDITPGPNAMWTYAVKKITM 267 Score = 37.0 bits (84), Expect(2) = 7e-09 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -3 Query: 117 LKKLTFSKKQVVPVLLSAKAENLE 46 +KK+T SKKQ+VP+LL KAENLE Sbjct: 262 VKKITMSKKQLVPLLLIPKAENLE 285 >ref|XP_003634840.1| PREDICTED: putative quinone-oxidoreductase homolog, chloroplastic [Vitis vinifera] Length = 329 Score = 42.4 bits (98), Expect(2) = 2e-08 Identities = 21/26 (80%), Positives = 23/26 (88%) Frame = -3 Query: 123 F*LKKLTFSKKQVVPVLLSAKAENLE 46 F LKKLTFSKKQ+VP+LLS K ENLE Sbjct: 260 FALKKLTFSKKQLVPLLLSPKKENLE 285 Score = 40.8 bits (94), Expect(2) = 2e-08 Identities = 18/31 (58%), Positives = 24/31 (77%) Frame = -2 Query: 199 STFEPNLSEYGKVIDITPGPRALMTLLIEEI 107 STFEPNLS GKVIDITP A++T ++++ Sbjct: 235 STFEPNLSTNGKVIDITPNASAMVTFALKKL 265 >dbj|BAJ34603.1| unnamed protein product [Thellungiella halophila] Length = 329 Score = 45.8 bits (107), Expect(2) = 3e-08 Identities = 20/33 (60%), Positives = 26/33 (78%) Frame = -2 Query: 199 STFEPNLSEYGKVIDITPGPRALMTLLIEEINL 101 STFEPNL+ GKVIDITPGP A+ T +++I + Sbjct: 235 STFEPNLAANGKVIDITPGPSAMWTYAVKKITM 267 Score = 37.0 bits (84), Expect(2) = 3e-08 Identities = 17/24 (70%), Positives = 21/24 (87%) Frame = -3 Query: 117 LKKLTFSKKQVVPVLLSAKAENLE 46 +KK+T SKKQ+VP+LL KAENLE Sbjct: 262 VKKITMSKKQLVPLLLIPKAENLE 285