BLASTX nr result
ID: Coptis23_contig00028238
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00028238 (294 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002303099.1| flavine-containing monoxygenase [Populus tri... 58 7e-07 ref|XP_002521164.1| monooxygenase, putative [Ricinus communis] g... 57 2e-06 ref|XP_003521326.1| PREDICTED: flavin-containing monooxygenase Y... 57 2e-06 ref|XP_004140585.1| PREDICTED: flavin-containing monooxygenase Y... 56 4e-06 ref|XP_003535245.1| PREDICTED: flavin-containing monooxygenase Y... 56 4e-06 >ref|XP_002303099.1| flavine-containing monoxygenase [Populus trichocarpa] gi|222844825|gb|EEE82372.1| flavine-containing monoxygenase [Populus trichocarpa] Length = 422 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 95 MFPVFDNEDFSSRRCVWVNGPVIVGAGPSGL 3 MF + D+EDF SRRC+WVNGPVIVGAGPSGL Sbjct: 4 MFRLADHEDFFSRRCIWVNGPVIVGAGPSGL 34 >ref|XP_002521164.1| monooxygenase, putative [Ricinus communis] gi|223539733|gb|EEF41315.1| monooxygenase, putative [Ricinus communis] Length = 423 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -2 Query: 95 MFPVFDNEDFSSRRCVWVNGPVIVGAGPSGL 3 +F + D+EDF SRRC+WVNGPVIVGAGPSGL Sbjct: 4 LFRLADHEDFFSRRCIWVNGPVIVGAGPSGL 34 >ref|XP_003521326.1| PREDICTED: flavin-containing monooxygenase YUCCA8-like [Glycine max] Length = 424 Score = 56.6 bits (135), Expect = 2e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -2 Query: 95 MFPVFDNEDFSSRRCVWVNGPVIVGAGPSGL 3 +F + DNED SRRC+WVNGP+IVGAGPSGL Sbjct: 4 LFRLVDNEDLFSRRCIWVNGPIIVGAGPSGL 34 >ref|XP_004140585.1| PREDICTED: flavin-containing monooxygenase YUCCA8-like [Cucumis sativus] gi|449522428|ref|XP_004168228.1| PREDICTED: flavin-containing monooxygenase YUCCA8-like [Cucumis sativus] Length = 423 Score = 55.8 bits (133), Expect = 4e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -2 Query: 95 MFPVFDNEDFSSRRCVWVNGPVIVGAGPSGL 3 +F + D++DF SRRC+WVNGPVIVGAGPSGL Sbjct: 4 LFRLADHDDFFSRRCIWVNGPVIVGAGPSGL 34 >ref|XP_003535245.1| PREDICTED: flavin-containing monooxygenase YUCCA3-like [Glycine max] Length = 441 Score = 55.8 bits (133), Expect = 4e-06 Identities = 24/33 (72%), Positives = 25/33 (75%) Frame = -2 Query: 101 PKMFPVFDNEDFSSRRCVWVNGPVIVGAGPSGL 3 P M FD ED RRC+WVNGPVIVGAGPSGL Sbjct: 9 PPMVQTFDPEDLFKRRCIWVNGPVIVGAGPSGL 41