BLASTX nr result
ID: Coptis23_contig00028121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00028121 (340 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002315793.1| predicted protein [Populus trichocarpa] gi|2... 110 2e-22 ref|XP_002311601.1| predicted protein [Populus trichocarpa] gi|1... 110 2e-22 ref|NP_172893.1| ssDNA-binding transcriptional regulator [Arabid... 109 2e-22 ref|XP_002892804.1| ATWHY1/PTAC1 [Arabidopsis lyrata subsp. lyra... 109 2e-22 ref|XP_002520128.1| conserved hypothetical protein [Ricinus comm... 109 3e-22 >ref|XP_002315793.1| predicted protein [Populus trichocarpa] gi|222864833|gb|EEF01964.1| predicted protein [Populus trichocarpa] Length = 191 Score = 110 bits (274), Expect = 2e-22 Identities = 51/59 (86%), Positives = 57/59 (96%) Frame = -3 Query: 179 SDEGKVRKVLKAEPLPDGSGHFFNLSVQNKLLNVDESIYIPVSKAEFTVLVSAFNYILP 3 S+EGKVRKVLK EPLPDGSGHFFNLSVQNK LN+DESIYIPV++AE+TVL+SAFNYILP Sbjct: 96 SEEGKVRKVLKVEPLPDGSGHFFNLSVQNKALNIDESIYIPVTRAEYTVLISAFNYILP 154 >ref|XP_002311601.1| predicted protein [Populus trichocarpa] gi|118485247|gb|ABK94483.1| unknown [Populus trichocarpa] gi|222851421|gb|EEE88968.1| predicted protein [Populus trichocarpa] Length = 265 Score = 110 bits (274), Expect = 2e-22 Identities = 51/59 (86%), Positives = 57/59 (96%) Frame = -3 Query: 179 SDEGKVRKVLKAEPLPDGSGHFFNLSVQNKLLNVDESIYIPVSKAEFTVLVSAFNYILP 3 SDEGKVRK+LK EPLPDGSGHFFNLSVQNK+LN+DE+IYIPV+KAE+TVL SAFNYILP Sbjct: 172 SDEGKVRKLLKVEPLPDGSGHFFNLSVQNKVLNIDENIYIPVTKAEYTVLTSAFNYILP 230 >ref|NP_172893.1| ssDNA-binding transcriptional regulator [Arabidopsis thaliana] gi|75191428|sp|Q9M9S3.1|WHY1_ARATH RecName: Full=Single-stranded DNA-binding protein WHY1, chloroplastic; AltName: Full=Protein PLASTID TRANSCRIPTIONALLY ACTIVE 1; AltName: Full=Protein WHIRLY 1; Short=AtWHY1; Flags: Precursor gi|7262683|gb|AAF43941.1|AC012188_18 Contains similarity to a hypothetical protein from Arabidopsis thaliana gb|AC002521.2. EST gb|AI995686 comes from this gene [Arabidopsis thaliana] gi|12083312|gb|AAG48815.1|AF332452_1 putative DNA-binding protein p24 [Arabidopsis thaliana] gi|13877787|gb|AAK43971.1|AF370156_1 putative DNA-binding protein p24 [Arabidopsis thaliana] gi|16323418|gb|AAL15203.1| putative DNA-binding protein p24 [Arabidopsis thaliana] gi|332191039|gb|AEE29160.1| ssDNA-binding transcriptional regulator [Arabidopsis thaliana] Length = 263 Score = 109 bits (273), Expect = 2e-22 Identities = 50/59 (84%), Positives = 57/59 (96%) Frame = -3 Query: 179 SDEGKVRKVLKAEPLPDGSGHFFNLSVQNKLLNVDESIYIPVSKAEFTVLVSAFNYILP 3 SDEGKVRKVLK EPLPDGSGHFFNLSVQNKL+NVDESIYIP+++AEF VL+SAFN++LP Sbjct: 170 SDEGKVRKVLKVEPLPDGSGHFFNLSVQNKLVNVDESIYIPITRAEFAVLISAFNFVLP 228 >ref|XP_002892804.1| ATWHY1/PTAC1 [Arabidopsis lyrata subsp. lyrata] gi|297338646|gb|EFH69063.1| ATWHY1/PTAC1 [Arabidopsis lyrata subsp. lyrata] Length = 264 Score = 109 bits (273), Expect = 2e-22 Identities = 50/59 (84%), Positives = 57/59 (96%) Frame = -3 Query: 179 SDEGKVRKVLKAEPLPDGSGHFFNLSVQNKLLNVDESIYIPVSKAEFTVLVSAFNYILP 3 SDEGKVRKVLK EPLPDGSGHFFNLSVQNKL+NVDESIYIP+++AEF VL+SAFN++LP Sbjct: 171 SDEGKVRKVLKVEPLPDGSGHFFNLSVQNKLVNVDESIYIPITRAEFAVLISAFNFVLP 229 >ref|XP_002520128.1| conserved hypothetical protein [Ricinus communis] gi|223540620|gb|EEF42183.1| conserved hypothetical protein [Ricinus communis] Length = 271 Score = 109 bits (272), Expect = 3e-22 Identities = 51/59 (86%), Positives = 56/59 (94%) Frame = -3 Query: 179 SDEGKVRKVLKAEPLPDGSGHFFNLSVQNKLLNVDESIYIPVSKAEFTVLVSAFNYILP 3 SDEGK+RKVLK EPLPDGSGHFFNLSVQNK +N+DESIYIPV+KAEF VL+SAFNYILP Sbjct: 178 SDEGKIRKVLKVEPLPDGSGHFFNLSVQNKPMNMDESIYIPVTKAEFAVLISAFNYILP 236