BLASTX nr result
ID: Coptis23_contig00027995
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00027995 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279278.2| PREDICTED: nipped-B-like protein-like [Vitis... 69 4e-10 emb|CBI22299.3| unnamed protein product [Vitis vinifera] 69 4e-10 ref|XP_003618719.1| Sister chromatid cohesion [Medicago truncatu... 67 1e-09 ref|XP_003554911.1| PREDICTED: nipped-B-like protein-like [Glyci... 66 3e-09 ref|XP_003543868.1| PREDICTED: nipped-B-like protein-like [Glyci... 65 6e-09 >ref|XP_002279278.2| PREDICTED: nipped-B-like protein-like [Vitis vinifera] Length = 1967 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/63 (49%), Positives = 44/63 (69%) Frame = -1 Query: 250 RSIDRSEVVVHASRIAHLLKDTDVSYLKLKDAACNIPHSFEHSSTLFKEVLKYNSEAFEY 71 RS++R +V+ ASRIA LL++TD+SYL L+D C+ P+ F L+ EV++ N EAFEY Sbjct: 61 RSLNRRDVISQASRIADLLRETDISYLNLRDDECSFPYGFVEPLVLYDEVVRCNPEAFEY 120 Query: 70 TVP 62 P Sbjct: 121 ITP 123 >emb|CBI22299.3| unnamed protein product [Vitis vinifera] Length = 1748 Score = 68.9 bits (167), Expect = 4e-10 Identities = 31/63 (49%), Positives = 44/63 (69%) Frame = -1 Query: 250 RSIDRSEVVVHASRIAHLLKDTDVSYLKLKDAACNIPHSFEHSSTLFKEVLKYNSEAFEY 71 RS++R +V+ ASRIA LL++TD+SYL L+D C+ P+ F L+ EV++ N EAFEY Sbjct: 61 RSLNRRDVISQASRIADLLRETDISYLNLRDDECSFPYGFVEPLVLYDEVVRCNPEAFEY 120 Query: 70 TVP 62 P Sbjct: 121 ITP 123 >ref|XP_003618719.1| Sister chromatid cohesion [Medicago truncatula] gi|355493734|gb|AES74937.1| Sister chromatid cohesion [Medicago truncatula] Length = 1167 Score = 67.4 bits (163), Expect = 1e-09 Identities = 34/80 (42%), Positives = 53/80 (66%) Frame = -1 Query: 244 IDRSEVVVHASRIAHLLKDTDVSYLKLKDAACNIPHSFEHSSTLFKEVLKYNSEAFEYTV 65 ++R E++ +S+IA +L++TDVSYL L+D A +P+++ L EVL+ N EAFE + Sbjct: 61 LNRVEILSQSSKIAEMLRNTDVSYLNLRDDAKTVPYNYAEPLELHDEVLRCNPEAFECSH 120 Query: 64 PGFIKERSSNSVVSEKKLYE 5 G +KE+ S S + E KL E Sbjct: 121 EGPVKEKISGSALPETKLSE 140 >ref|XP_003554911.1| PREDICTED: nipped-B-like protein-like [Glycine max] Length = 1655 Score = 65.9 bits (159), Expect = 3e-09 Identities = 34/81 (41%), Positives = 53/81 (65%), Gaps = 1/81 (1%) Frame = -1 Query: 244 IDRSEVVVHASRIAHLLKDTDVSYLKLKDAACNIPHSFEHSSTLFKEVLKYNSEAFEYTV 65 ++R +V+ +++IA LL+ TDVSYL L+D A +P+ + L EVL+ N EAFEY+ Sbjct: 59 LNRVDVLAQSAKIAELLRHTDVSYLNLRDEAKGVPYIYVEPLELHDEVLRCNPEAFEYST 118 Query: 64 PGFIKER-SSNSVVSEKKLYE 5 G +KE+ S ++ V EK+ E Sbjct: 119 AGHVKEQISGSAAVPEKRQSE 139 >ref|XP_003543868.1| PREDICTED: nipped-B-like protein-like [Glycine max] Length = 1723 Score = 65.1 bits (157), Expect = 6e-09 Identities = 32/77 (41%), Positives = 50/77 (64%) Frame = -1 Query: 244 IDRSEVVVHASRIAHLLKDTDVSYLKLKDAACNIPHSFEHSSTLFKEVLKYNSEAFEYTV 65 ++R +V+ +++IA LL+ TDVSYL L+ A +P+ + L EV++ N EAFEY+ Sbjct: 61 LNRVDVLAQSAKIAELLRHTDVSYLNLRGEAKGVPYIYVEPLELHDEVIRCNPEAFEYST 120 Query: 64 PGFIKERSSNSVVSEKK 14 G +KE+ S VSEK+ Sbjct: 121 AGPVKEQIYGSAVSEKR 137