BLASTX nr result
ID: Coptis23_contig00027954
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00027954 (575 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002437558.1| hypothetical protein SORBIDRAFT_10g029370 [S... 56 5e-06 >ref|XP_002437558.1| hypothetical protein SORBIDRAFT_10g029370 [Sorghum bicolor] gi|241915781|gb|EER88925.1| hypothetical protein SORBIDRAFT_10g029370 [Sorghum bicolor] Length = 459 Score = 55.8 bits (133), Expect = 5e-06 Identities = 31/98 (31%), Positives = 54/98 (55%), Gaps = 7/98 (7%) Frame = +3 Query: 294 WSELREELVYSISQRFLLPDMIRFGCVCPSWKSV-SAPALRHKGRLPWLVVPYTADR--- 461 W++L +L+ S+ R +PD +RF VC +W+S +A ++H PWL++P+ Sbjct: 14 WADLPRDLLESVLARLPVPDRVRFPAVCTAWQSAHTAAGIQHAALSPWLMLPFNPTARVD 73 Query: 462 NVDESDNYC-RDGLLGFFSILDGITYKIE--TPELRER 566 +VD++D C + ++ F S+ + Y I P RER Sbjct: 74 SVDDNDGSCAKLTVVRFLSLAEDRAYAIRQPAPAARER 111