BLASTX nr result
ID: Coptis23_contig00027933
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00027933 (631 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300545.1| predicted protein [Populus trichocarpa] gi|2... 71 2e-10 ref|XP_002269984.1| PREDICTED: pentatricopeptide repeat-containi... 68 1e-09 ref|XP_002513427.1| pentatricopeptide repeat-containing protein,... 65 1e-08 ref|XP_002317023.1| predicted protein [Populus trichocarpa] gi|2... 65 1e-08 ref|XP_004144640.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 >ref|XP_002300545.1| predicted protein [Populus trichocarpa] gi|222847803|gb|EEE85350.1| predicted protein [Populus trichocarpa] Length = 567 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = -2 Query: 630 IIVEGIAHEEDLELAADVLKALYVRQVVSRNTVERLVMQYDLE 502 I+VEGIAHEE+ ELAA+VLK LY+RQV+ RNTVERLVMQYDL+ Sbjct: 521 ILVEGIAHEEEKELAAEVLKELYIRQVMRRNTVERLVMQYDLK 563 >ref|XP_002269984.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic [Vitis vinifera] gi|147852271|emb|CAN82234.1| hypothetical protein VITISV_038804 [Vitis vinifera] Length = 567 Score = 68.2 bits (165), Expect = 1e-09 Identities = 33/43 (76%), Positives = 39/43 (90%) Frame = -2 Query: 630 IIVEGIAHEEDLELAADVLKALYVRQVVSRNTVERLVMQYDLE 502 IIVEGIAH+E++ELAA VLK LY+RQ V R+T+ERLVMQYDLE Sbjct: 521 IIVEGIAHQEEMELAAAVLKELYLRQAVGRSTLERLVMQYDLE 563 >ref|XP_002513427.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223547335|gb|EEF48830.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 567 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/43 (69%), Positives = 40/43 (93%) Frame = -2 Query: 630 IIVEGIAHEEDLELAADVLKALYVRQVVSRNTVERLVMQYDLE 502 I+VEGI HEE+ ELAA+VL+ L++RQV+S++TVERL+MQYDLE Sbjct: 521 ILVEGIIHEEEKELAAEVLRELHLRQVMSQSTVERLIMQYDLE 563 >ref|XP_002317023.1| predicted protein [Populus trichocarpa] gi|222860088|gb|EEE97635.1| predicted protein [Populus trichocarpa] Length = 455 Score = 64.7 bits (156), Expect = 1e-08 Identities = 32/43 (74%), Positives = 38/43 (88%) Frame = -2 Query: 630 IIVEGIAHEEDLELAADVLKALYVRQVVSRNTVERLVMQYDLE 502 IIVEGIAHEE+ ELAA+VLK L +RQV+ RNT ERLV+QY+LE Sbjct: 409 IIVEGIAHEEEKELAAEVLKELLLRQVMRRNTAERLVLQYNLE 451 >ref|XP_004144640.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79080, chloroplastic-like [Cucumis sativus] Length = 566 Score = 57.4 bits (137), Expect = 2e-06 Identities = 26/47 (55%), Positives = 39/47 (82%) Frame = -2 Query: 630 IIVEGIAHEEDLELAADVLKALYVRQVVSRNTVERLVMQYDLE*IAL 490 I+VEGI HE++++LA +VL+ L +R V++++TVERLVMQYDL + L Sbjct: 520 ILVEGIIHEKEMDLATEVLRELQLRDVINQSTVERLVMQYDLNELPL 566