BLASTX nr result
ID: Coptis23_contig00027908
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00027908 (282 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002268027.1| PREDICTED: uncharacterized protein LOC100260... 56 3e-06 >ref|XP_002268027.1| PREDICTED: uncharacterized protein LOC100260319 [Vitis vinifera] gi|296086507|emb|CBI32096.3| unnamed protein product [Vitis vinifera] Length = 192 Score = 55.8 bits (133), Expect = 3e-06 Identities = 30/51 (58%), Positives = 39/51 (76%) Frame = +3 Query: 129 QPLLFSPCLLFSTSLRMSKHHLCRAEAEYQFPDPIPDFAEAETDKFKNHLL 281 QP L S L+FS+S +H+CRA AEY+FPDPIP+FA+ ET+KF+ HLL Sbjct: 62 QPQLHS--LVFSSS--SFANHICRA-AEYKFPDPIPEFAQVETEKFRTHLL 107