BLASTX nr result
ID: Coptis23_contig00027816
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00027816 (466 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002866395.1| hypothetical protein ARALYDRAFT_496228 [Arab... 55 8e-06 >ref|XP_002866395.1| hypothetical protein ARALYDRAFT_496228 [Arabidopsis lyrata subsp. lyrata] gi|297312230|gb|EFH42654.1| hypothetical protein ARALYDRAFT_496228 [Arabidopsis lyrata subsp. lyrata] Length = 284 Score = 54.7 bits (130), Expect = 8e-06 Identities = 25/42 (59%), Positives = 32/42 (76%) Frame = +2 Query: 170 VTTLVLRIDFHCGGCAKKIQKTIAKFKGVHNIWVDYKENLVT 295 VTT VL+++FHC GC KIQKTI K KGV + +D ++NLVT Sbjct: 135 VTTAVLKLNFHCQGCIGKIQKTITKTKGVDGLTMDKEKNLVT 176