BLASTX nr result
ID: Coptis23_contig00027787
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00027787 (674 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004150192.1| PREDICTED: cysteine--tRNA ligase-like [Cucum... 55 3e-07 ref|XP_002262997.2| PREDICTED: cysteinyl-tRNA synthetase-like [V... 51 3e-06 >ref|XP_004150192.1| PREDICTED: cysteine--tRNA ligase-like [Cucumis sativus] gi|449508099|ref|XP_004163218.1| PREDICTED: cysteine--tRNA ligase-like [Cucumis sativus] Length = 562 Score = 54.7 bits (130), Expect(2) = 3e-07 Identities = 36/79 (45%), Positives = 41/79 (51%), Gaps = 24/79 (30%) Frame = -3 Query: 612 GHALASVSFDVLYR*LKR---------------QEMI---------PLAYSFGCIQ*FLK 505 GHA A+V+FDVLYR LK ++I P A S Q +L Sbjct: 43 GHARAAVNFDVLYRYLKHLGYEVTYVRNFTDVDDKIIRRANESGENPFALSDRFCQEYLS 102 Query: 504 DMEDLQCLSPTHQQRVSDH 448 DM DLQCLSPTHQ RVSDH Sbjct: 103 DMADLQCLSPTHQPRVSDH 121 Score = 25.4 bits (54), Expect(2) = 3e-07 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -1 Query: 653 KVKMYVCGITTY 618 KV MYVCGIT Y Sbjct: 26 KVGMYVCGITAY 37 >ref|XP_002262997.2| PREDICTED: cysteinyl-tRNA synthetase-like [Vitis vinifera] gi|297735988|emb|CBI23962.3| unnamed protein product [Vitis vinifera] Length = 513 Score = 50.8 bits (120), Expect(2) = 3e-06 Identities = 34/79 (43%), Positives = 39/79 (49%), Gaps = 24/79 (30%) Frame = -3 Query: 612 GHALASVSFDVLYR*LKR---------------QEMI---------PLAYSFGCIQ*FLK 505 GH A+VSFDVLYR L+ ++I PL S Q +L Sbjct: 44 GHGRAAVSFDVLYRYLQHLGYEVTYVRNFTDVDDKIIRRANELGENPLTLSSHFCQEYLD 103 Query: 504 DMEDLQCLSPTHQQRVSDH 448 DM DL CLSPTHQ RVSDH Sbjct: 104 DMTDLHCLSPTHQPRVSDH 122 Score = 25.8 bits (55), Expect(2) = 3e-06 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = -1 Query: 653 KVKMYVCGITTY 618 KV MYVCG+T Y Sbjct: 27 KVSMYVCGVTAY 38