BLASTX nr result
ID: Coptis23_contig00027734
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00027734 (422 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002533148.1| Protein kinase APK1B, chloroplast precursor,... 64 2e-08 gb|AFK44181.1| unknown [Lotus japonicus] 61 8e-08 ref|XP_003544233.1| PREDICTED: protein kinase APK1A, chloroplast... 60 2e-07 gb|AFK40483.1| unknown [Lotus japonicus] 59 5e-07 ref|XP_003519345.1| PREDICTED: protein kinase APK1A, chloroplast... 58 9e-07 >ref|XP_002533148.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus communis] gi|223527043|gb|EEF29229.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus communis] Length = 410 Score = 63.5 bits (153), Expect = 2e-08 Identities = 34/60 (56%), Positives = 41/60 (68%) Frame = -3 Query: 420 GQYSLADAKKIANIALQCTSNEAKHRPKMDEVVKALEELQVSIDETHPK*SWPESLNSFN 241 GQYSL DA K+AN+A+QC S E + RPKM+EVVKALE+L S D + S ESL N Sbjct: 316 GQYSLKDALKVANLAVQCISPEPRFRPKMEEVVKALEQLLESNDNEGSRGSRHESLRKVN 375 >gb|AFK44181.1| unknown [Lotus japonicus] Length = 401 Score = 61.2 bits (147), Expect = 8e-08 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = -3 Query: 420 GQYSLADAKKIANIALQCTSNEAKHRPKMDEVVKALEELQVSIDET 283 GQY+L +A K+AN+A+QC S E + RPKMDEVV LEELQ S D+T Sbjct: 323 GQYTLREAMKVANLAIQCLSVEPRFRPKMDEVVSVLEELQGSHDDT 368 >ref|XP_003544233.1| PREDICTED: protein kinase APK1A, chloroplastic-like [Glycine max] Length = 399 Score = 59.7 bits (143), Expect = 2e-07 Identities = 28/44 (63%), Positives = 36/44 (81%) Frame = -3 Query: 420 GQYSLADAKKIANIALQCTSNEAKHRPKMDEVVKALEELQVSID 289 GQY+L ++ K+AN+A+QC S E + RPKMDEVV+ALEELQ S D Sbjct: 318 GQYTLRESMKVANLAIQCLSVEPRFRPKMDEVVRALEELQDSED 361 >gb|AFK40483.1| unknown [Lotus japonicus] Length = 163 Score = 58.5 bits (140), Expect = 5e-07 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -3 Query: 420 GQYSLADAKKIANIALQCTSNEAKHRPKMDEVVKALEELQVS 295 GQYS +A K+A +AL+C S E+K RP MDEVVKALE+LQVS Sbjct: 75 GQYSSDEAYKVATLALRCLSTESKFRPNMDEVVKALEQLQVS 116 >ref|XP_003519345.1| PREDICTED: protein kinase APK1A, chloroplastic-like isoform 2 [Glycine max] Length = 390 Score = 57.8 bits (138), Expect = 9e-07 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = -3 Query: 420 GQYSLADAKKIANIALQCTSNEAKHRPKMDEVVKALEELQVSID 289 GQY L +A K+A +A+QC S E + RPKMDEVV+ALEELQ S D Sbjct: 316 GQYMLREAMKVATLAIQCLSVEPRFRPKMDEVVRALEELQDSDD 359