BLASTX nr result
ID: Coptis23_contig00027702
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00027702 (524 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004156807.1| PREDICTED: peptide deformylase 1A, chloropla... 57 2e-06 ref|XP_004156806.1| PREDICTED: peptide deformylase 1A, chloropla... 57 2e-06 ref|XP_004152208.1| PREDICTED: LOW QUALITY PROTEIN: peptide defo... 57 2e-06 dbj|BAJ53237.1| JHL06P13.18 [Jatropha curcas] 56 3e-06 ref|NP_001234703.1| peptide deformylase 1A, chloroplastic [Solan... 56 4e-06 >ref|XP_004156807.1| PREDICTED: peptide deformylase 1A, chloroplastic-like isoform 2 [Cucumis sativus] Length = 237 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = +3 Query: 3 LDGTIYVDKLVPRTFRTVENLNLPLPNGYHKLGVR 107 LDGT+YVDK+VPRTFRT ENL LPL G KLG R Sbjct: 203 LDGTLYVDKMVPRTFRTTENLTLPLAEGCPKLGAR 237 >ref|XP_004156806.1| PREDICTED: peptide deformylase 1A, chloroplastic-like isoform 1 [Cucumis sativus] Length = 267 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = +3 Query: 3 LDGTIYVDKLVPRTFRTVENLNLPLPNGYHKLGVR 107 LDGT+YVDK+VPRTFRT ENL LPL G KLG R Sbjct: 233 LDGTLYVDKMVPRTFRTTENLTLPLAEGCPKLGAR 267 >ref|XP_004152208.1| PREDICTED: LOW QUALITY PROTEIN: peptide deformylase 1A, chloroplastic-like [Cucumis sativus] Length = 267 Score = 56.6 bits (135), Expect = 2e-06 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = +3 Query: 3 LDGTIYVDKLVPRTFRTVENLNLPLPNGYHKLGVR 107 LDGT+YVDK+VPRTFRT ENL LPL G KLG R Sbjct: 233 LDGTLYVDKMVPRTFRTTENLTLPLAEGCPKLGAR 267 >dbj|BAJ53237.1| JHL06P13.18 [Jatropha curcas] Length = 274 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +3 Query: 3 LDGTIYVDKLVPRTFRTVENLNLPLPNGYHKLGVR 107 LDGT+YVDK+VPRTFRT+ENL+LPL G LG R Sbjct: 240 LDGTLYVDKMVPRTFRTIENLDLPLAEGCPNLGAR 274 >ref|NP_001234703.1| peptide deformylase 1A, chloroplastic [Solanum lycopersicum] gi|17433049|sp|Q9FUZ0.1|DEF1A_SOLLC RecName: Full=Peptide deformylase 1A, chloroplastic; Short=PDF 1A; AltName: Full=Polypeptide deformylase; Flags: Precursor gi|11320968|gb|AAG33981.1|AF271258_1 peptide deformylase-like protein [Solanum lycopersicum] Length = 277 Score = 55.8 bits (133), Expect = 4e-06 Identities = 26/34 (76%), Positives = 29/34 (85%) Frame = +3 Query: 3 LDGTIYVDKLVPRTFRTVENLNLPLPNGYHKLGV 104 LDGT+YVDK+ PRTFRTVENL+LPL G KLGV Sbjct: 243 LDGTLYVDKMAPRTFRTVENLDLPLAAGCPKLGV 276