BLASTX nr result
ID: Coptis23_contig00027646
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00027646 (302 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CCC55423.1| caffeic acid O-3-methyltransferase [Pinus pinaster] 109 2e-22 gb|ACB59042.1| caffeic acid O-3-methyltransferase-like protein [... 107 8e-22 gb|ACB59041.1| caffeic acid O-3-methyltransferase-like protein [... 107 8e-22 gb|ACB59040.1| caffeic acid O-3-methyltransferase-like protein [... 107 8e-22 gb|ACB59039.1| caffeic acid O-3-methyltransferase-like protein [... 107 8e-22 >emb|CCC55423.1| caffeic acid O-3-methyltransferase [Pinus pinaster] Length = 364 Score = 109 bits (273), Expect = 2e-22 Identities = 46/81 (56%), Positives = 65/81 (80%) Frame = +2 Query: 59 SYSFVSCSTVSDENGHTERLYGLVPISKSFVRDQDGLSMSPMLMMVGDKVVMETWYHLKD 238 S+S +SCS +DENG ERLYGL P+ K V++QDG+S++P+++M DKV+ME+WY+LKD Sbjct: 86 SHSVLSCSVTTDENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYLKD 145 Query: 239 AILDGGIPFNKAHGIESYRYP 301 A+LDG PF KAHG+ ++ YP Sbjct: 146 AVLDGSQPFTKAHGMNAFEYP 166 >gb|ACB59042.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] Length = 115 Score = 107 bits (268), Expect = 8e-22 Identities = 45/81 (55%), Positives = 65/81 (80%) Frame = +2 Query: 59 SYSFVSCSTVSDENGHTERLYGLVPISKSFVRDQDGLSMSPMLMMVGDKVVMETWYHLKD 238 S+S +SCS ++ENG ERLYGL P+ K V++QDG+S++P+++M DKV+ME+WY+LKD Sbjct: 35 SHSVLSCSVTTNENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYLKD 94 Query: 239 AILDGGIPFNKAHGIESYRYP 301 A+LDG PF KAHG+ ++ YP Sbjct: 95 AVLDGSQPFTKAHGMNAFEYP 115 >gb|ACB59041.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] gi|171919669|gb|ACB59043.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] gi|171919673|gb|ACB59045.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] gi|171919675|gb|ACB59046.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] gi|171919677|gb|ACB59047.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] gi|171919681|gb|ACB59049.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] gi|171919683|gb|ACB59050.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] gi|171919690|gb|ACB59053.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] gi|171919696|gb|ACB59056.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] gi|171919702|gb|ACB59059.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] gi|171919704|gb|ACB59060.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] gi|171919708|gb|ACB59062.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] gi|171919712|gb|ACB59064.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] gi|171919716|gb|ACB59066.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] Length = 148 Score = 107 bits (268), Expect = 8e-22 Identities = 45/81 (55%), Positives = 65/81 (80%) Frame = +2 Query: 59 SYSFVSCSTVSDENGHTERLYGLVPISKSFVRDQDGLSMSPMLMMVGDKVVMETWYHLKD 238 S+S +SCS ++ENG ERLYGL P+ K V++QDG+S++P+++M DKV+ME+WY+LKD Sbjct: 35 SHSVLSCSVTTNENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYLKD 94 Query: 239 AILDGGIPFNKAHGIESYRYP 301 A+LDG PF KAHG+ ++ YP Sbjct: 95 AVLDGSQPFTKAHGMNAFEYP 115 >gb|ACB59040.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] gi|171919671|gb|ACB59044.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] gi|171919679|gb|ACB59048.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] gi|171919686|gb|ACB59051.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] gi|171919692|gb|ACB59054.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] gi|171919694|gb|ACB59055.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] gi|171919698|gb|ACB59057.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] gi|171919700|gb|ACB59058.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] gi|171919706|gb|ACB59061.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] gi|171919710|gb|ACB59063.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] gi|171919714|gb|ACB59065.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] gi|171919718|gb|ACB59067.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] Length = 148 Score = 107 bits (268), Expect = 8e-22 Identities = 45/81 (55%), Positives = 65/81 (80%) Frame = +2 Query: 59 SYSFVSCSTVSDENGHTERLYGLVPISKSFVRDQDGLSMSPMLMMVGDKVVMETWYHLKD 238 S+S +SCS + ENG ERLYGL P+ K V++QDG+S++P+++M DKV+ME+WY+LKD Sbjct: 35 SHSVLSCSVTTSENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYLKD 94 Query: 239 AILDGGIPFNKAHGIESYRYP 301 A+LDG PF+KAHG+ ++ YP Sbjct: 95 AVLDGSQPFSKAHGMNAFEYP 115 >gb|ACB59039.1| caffeic acid O-3-methyltransferase-like protein [Pinus taeda] Length = 147 Score = 107 bits (268), Expect = 8e-22 Identities = 45/81 (55%), Positives = 65/81 (80%) Frame = +2 Query: 59 SYSFVSCSTVSDENGHTERLYGLVPISKSFVRDQDGLSMSPMLMMVGDKVVMETWYHLKD 238 S+S +SCS ++ENG ERLYGL P+ K V++QDG+S++P+++M DKV+ME+WY+LKD Sbjct: 35 SHSVLSCSVTTNENGKAERLYGLTPLCKYLVKNQDGVSLAPLVLMNQDKVLMESWYYLKD 94 Query: 239 AILDGGIPFNKAHGIESYRYP 301 A+LDG PF KAHG+ ++ YP Sbjct: 95 AVLDGSQPFTKAHGMNAFEYP 115