BLASTX nr result
ID: Coptis23_contig00027398
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00027398 (481 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535798.1| conserved hypothetical protein [Ricinus comm... 73 2e-11 ref|NP_064030.1| orf129c gene product (mitochondrion) [Beta vulg... 67 1e-09 ref|XP_002522075.1| conserved hypothetical protein [Ricinus comm... 67 1e-09 >ref|XP_002535798.1| conserved hypothetical protein [Ricinus communis] gi|223521924|gb|EEF26587.1| conserved hypothetical protein [Ricinus communis] Length = 51 Score = 73.2 bits (178), Expect = 2e-11 Identities = 36/43 (83%), Positives = 38/43 (88%), Gaps = 1/43 (2%) Frame = +3 Query: 84 NHSLSTTHKTTEIFDLAPKG-NPLGPFPTYTKRAEDNERETRS 209 N SLSTTHKTTEIFDLAPKG NP GP PTYT+ AEDNERET+S Sbjct: 9 NRSLSTTHKTTEIFDLAPKGNNPPGPSPTYTRGAEDNERETKS 51 >ref|NP_064030.1| orf129c gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|9049331|dbj|BAA99341.1| orf129c [Beta vulgaris subsp. vulgaris] Length = 129 Score = 67.4 bits (163), Expect = 1e-09 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +3 Query: 282 GWRGIRTPGIPINTWVFKTDSFNRSDIHPLR 374 GWRGIRTPGIPINT VFKTDSFNRSDIHPLR Sbjct: 4 GWRGIRTPGIPINTSVFKTDSFNRSDIHPLR 34 >ref|XP_002522075.1| conserved hypothetical protein [Ricinus communis] gi|223538674|gb|EEF40275.1| conserved hypothetical protein [Ricinus communis] Length = 207 Score = 67.0 bits (162), Expect = 1e-09 Identities = 34/49 (69%), Positives = 38/49 (77%) Frame = -1 Query: 442 ASVANHINKPLPTSARIDRACEARRGWMSERLKESVLKTQVLIGIPGVR 296 A + KPLP ARIDRA EA+RGWMSERLKESVLKT+VLIGI G + Sbjct: 93 APAGSATTKPLPARARIDRAGEAQRGWMSERLKESVLKTKVLIGILGFK 141