BLASTX nr result
ID: Coptis23_contig00027372
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00027372 (320 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002273156.2| PREDICTED: pentatricopeptide repeat-containi... 108 6e-25 emb|CBI24939.3| unnamed protein product [Vitis vinifera] 108 6e-25 ref|XP_002517779.1| pentatricopeptide repeat-containing protein,... 106 1e-24 ref|XP_003599420.1| Pentatricopeptide repeat-containing protein ... 101 1e-23 ref|XP_002313317.1| predicted protein [Populus trichocarpa] gi|2... 103 3e-23 >ref|XP_002273156.2| PREDICTED: pentatricopeptide repeat-containing protein At3g53170-like [Vitis vinifera] Length = 538 Score = 108 bits (269), Expect(2) = 6e-25 Identities = 50/74 (67%), Positives = 60/74 (81%) Frame = -1 Query: 320 LVNFYSKTEELNKISLILRQVENSDVVLDTPIFNCVISAYGQVGELQRMEEMFVEMKRRK 141 LV+ YSK L K+ ILRQ+ENSDV LDTP FNCV+SAYGQ G+++RM E+F+ MK RK Sbjct: 381 LVSAYSKAGYLKKVDSILRQIENSDVTLDTPFFNCVLSAYGQAGDVERMGELFLVMKERK 440 Query: 140 CMPDNVTFATMIQA 99 C PDN+TFATMIQA Sbjct: 441 CKPDNITFATMIQA 454 Score = 30.8 bits (68), Expect(2) = 6e-25 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -3 Query: 96 QAYTVQGMTESAQQLETSLLNIKENS 19 QAY QGM E+AQ LE +++ K S Sbjct: 453 QAYNAQGMIEAAQNLEVNMITTKNKS 478 >emb|CBI24939.3| unnamed protein product [Vitis vinifera] Length = 485 Score = 108 bits (269), Expect(2) = 6e-25 Identities = 50/74 (67%), Positives = 60/74 (81%) Frame = -1 Query: 320 LVNFYSKTEELNKISLILRQVENSDVVLDTPIFNCVISAYGQVGELQRMEEMFVEMKRRK 141 LV+ YSK L K+ ILRQ+ENSDV LDTP FNCV+SAYGQ G+++RM E+F+ MK RK Sbjct: 381 LVSAYSKAGYLKKVDSILRQIENSDVTLDTPFFNCVLSAYGQAGDVERMGELFLVMKERK 440 Query: 140 CMPDNVTFATMIQA 99 C PDN+TFATMIQA Sbjct: 441 CKPDNITFATMIQA 454 Score = 30.8 bits (68), Expect(2) = 6e-25 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -3 Query: 96 QAYTVQGMTESAQQLETSLLNIKENS 19 QAY QGM E+AQ LE +++ K S Sbjct: 453 QAYNAQGMIEAAQNLEVNMITTKNKS 478 >ref|XP_002517779.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223543051|gb|EEF44586.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 486 Score = 106 bits (265), Expect(2) = 1e-24 Identities = 50/74 (67%), Positives = 62/74 (83%) Frame = -1 Query: 320 LVNFYSKTEELNKISLILRQVENSDVVLDTPIFNCVISAYGQVGELQRMEEMFVEMKRRK 141 LV+ YSK L K++ ILRQVENSDVVLDT FNC+I+AYGQ G++ +M E+F+EM+ R+ Sbjct: 381 LVSAYSKAGLLMKVNSILRQVENSDVVLDTTFFNCIINAYGQAGDVDKMAELFLEMRERE 440 Query: 140 CMPDNVTFATMIQA 99 CMPDNVTFATMIQA Sbjct: 441 CMPDNVTFATMIQA 454 Score = 31.6 bits (70), Expect(2) = 1e-24 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = -3 Query: 96 QAYTVQGMTESAQQLETSLLNIKENS 19 QAY QGMTE+AQ LE +L K NS Sbjct: 453 QAYRGQGMTEAAQALEKMMLAAKGNS 478 >ref|XP_003599420.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355488468|gb|AES69671.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 511 Score = 101 bits (252), Expect(2) = 1e-23 Identities = 48/74 (64%), Positives = 57/74 (77%) Frame = -1 Query: 320 LVNFYSKTEELNKISLILRQVENSDVVLDTPIFNCVISAYGQVGELQRMEEMFVEMKRRK 141 LVN YSK + KI ILR VENSDV+LDTP FNC+ISAYGQVG+L++M E+F+ M+ RK Sbjct: 385 LVNAYSKAGLIRKIDSILRHVENSDVILDTPFFNCIISAYGQVGDLKKMGELFLAMRARK 444 Query: 140 CMPDNVTFATMIQA 99 C PD TF MIQA Sbjct: 445 CEPDRTTFTCMIQA 458 Score = 32.7 bits (73), Expect(2) = 1e-23 Identities = 13/26 (50%), Positives = 21/26 (80%) Frame = -3 Query: 96 QAYTVQGMTESAQQLETSLLNIKENS 19 QAY QG+TE+A+ LET +++ K++S Sbjct: 457 QAYNTQGITEAAKNLETMMISAKDSS 482 >ref|XP_002313317.1| predicted protein [Populus trichocarpa] gi|222849725|gb|EEE87272.1| predicted protein [Populus trichocarpa] Length = 474 Score = 103 bits (258), Expect(2) = 3e-23 Identities = 47/74 (63%), Positives = 61/74 (82%) Frame = -1 Query: 320 LVNFYSKTEELNKISLILRQVENSDVVLDTPIFNCVISAYGQVGELQRMEEMFVEMKRRK 141 LV+ YSK + K+ ILRQVENSDV+LDTP FNCVISAYG+ G++++M E+F+ M+ RK Sbjct: 368 LVSAYSKAGHIMKVDSILRQVENSDVILDTPFFNCVISAYGRAGDIEKMSELFLGMEGRK 427 Query: 140 CMPDNVTFATMIQA 99 C PD++TFATMIQA Sbjct: 428 CKPDSITFATMIQA 441 Score = 29.3 bits (64), Expect(2) = 3e-23 Identities = 12/26 (46%), Positives = 18/26 (69%) Frame = -3 Query: 96 QAYTVQGMTESAQQLETSLLNIKENS 19 QAY QGM E+AQ +E ++ ++NS Sbjct: 440 QAYNAQGMIEAAQGMENMMIATRKNS 465