BLASTX nr result
ID: Coptis23_contig00027352
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00027352 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002326116.1| PAF1 complex component [Populus trichocarpa]... 62 6e-08 ref|XP_003533781.1| PREDICTED: RNA polymerase-associated protein... 61 8e-08 ref|XP_002516292.1| tpr repeat nuclear phosphoprotein, putative ... 61 8e-08 ref|XP_003546500.1| PREDICTED: RNA polymerase-associated protein... 61 1e-07 ref|XP_004144025.1| PREDICTED: RNA polymerase-associated protein... 60 1e-07 >ref|XP_002326116.1| PAF1 complex component [Populus trichocarpa] gi|222833309|gb|EEE71786.1| PAF1 complex component [Populus trichocarpa] Length = 1056 Score = 61.6 bits (148), Expect = 6e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -1 Query: 108 MIGALELENDDWLKAKETLRAAREATDGKDSYSALS 1 M+G LEL+NDDW+KAKET RAA EATDGKDSY+ LS Sbjct: 595 MLGDLELKNDDWVKAKETFRAASEATDGKDSYATLS 630 >ref|XP_003533781.1| PREDICTED: RNA polymerase-associated protein CTR9 homolog [Glycine max] Length = 1086 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = -1 Query: 108 MIGALELENDDWLKAKETLRAAREATDGKDSYSALS 1 M+G LEL+NDDW+KAKETLRAA +AT+GKDSY++LS Sbjct: 594 MLGELELKNDDWVKAKETLRAASDATEGKDSYASLS 629 >ref|XP_002516292.1| tpr repeat nuclear phosphoprotein, putative [Ricinus communis] gi|223544778|gb|EEF46294.1| tpr repeat nuclear phosphoprotein, putative [Ricinus communis] Length = 1065 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -1 Query: 108 MIGALELENDDWLKAKETLRAAREATDGKDSYSALS 1 M+G LEL+NDDW+KAKET RAA EATDGKDSY+ LS Sbjct: 571 MLGDLELKNDDWVKAKETFRAASEATDGKDSYAILS 606 >ref|XP_003546500.1| PREDICTED: RNA polymerase-associated protein CTR9 homolog [Glycine max] Length = 1088 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -1 Query: 108 MIGALELENDDWLKAKETLRAAREATDGKDSYSALS 1 M+G LEL+NDDW+KAKETLR A +ATDGKDSY+ LS Sbjct: 597 MLGELELKNDDWVKAKETLRTASDATDGKDSYATLS 632 >ref|XP_004144025.1| PREDICTED: RNA polymerase-associated protein CTR9 homolog [Cucumis sativus] Length = 1074 Score = 60.5 bits (145), Expect = 1e-07 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -1 Query: 108 MIGALELENDDWLKAKETLRAAREATDGKDSYSALS 1 M+G LEL+NDDW++AKET RAA EATDGKDSY+ LS Sbjct: 595 MLGELELKNDDWVRAKETFRAAGEATDGKDSYATLS 630