BLASTX nr result
ID: Coptis23_contig00027001
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00027001 (428 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002317089.1| predicted protein [Populus trichocarpa] gi|2... 95 5e-18 ref|XP_002523164.1| Reticuline oxidase precursor, putative [Rici... 94 2e-17 ref|XP_002523162.1| Reticuline oxidase precursor, putative [Rici... 94 2e-17 ref|XP_002538825.1| Reticuline oxidase precursor, putative [Rici... 94 2e-17 ref|XP_002317090.1| predicted protein [Populus trichocarpa] gi|2... 92 3e-17 >ref|XP_002317089.1| predicted protein [Populus trichocarpa] gi|222860154|gb|EEE97701.1| predicted protein [Populus trichocarpa] Length = 545 Score = 95.1 bits (235), Expect = 5e-18 Identities = 44/68 (64%), Positives = 54/68 (79%) Frame = -3 Query: 423 SYVNYKDLELGMNRDIETSYLEASVWGKLYFKNNFERLAFVKSKVDPENFFWNEQSIPPL 244 +YVNY+DL+LGMN+ TS+ EASVWG YFKNNF RL VK+ VDP+NFF +EQSIPPL Sbjct: 470 AYVNYRDLDLGMNKKRNTSFKEASVWGTKYFKNNFNRLVQVKTTVDPDNFFRHEQSIPPL 529 Query: 243 LSSGKRGK 220 S ++GK Sbjct: 530 PLSSRKGK 537 >ref|XP_002523164.1| Reticuline oxidase precursor, putative [Ricinus communis] gi|223537571|gb|EEF39195.1| Reticuline oxidase precursor, putative [Ricinus communis] Length = 548 Score = 93.6 bits (231), Expect = 2e-17 Identities = 41/70 (58%), Positives = 58/70 (82%) Frame = -3 Query: 426 SSYVNYKDLELGMNRDIETSYLEASVWGKLYFKNNFERLAFVKSKVDPENFFWNEQSIPP 247 ++YVNY+DL+LGMN++ TS+++AS WG YFK+NF RL VK+KVDP+NFF +EQSIPP Sbjct: 471 TAYVNYRDLDLGMNKNSSTSFIQASAWGSKYFKDNFNRLVQVKTKVDPDNFFRHEQSIPP 530 Query: 246 LLSSGKRGKK 217 L +S +R ++ Sbjct: 531 LPASLRRKRR 540 >ref|XP_002523162.1| Reticuline oxidase precursor, putative [Ricinus communis] gi|223537569|gb|EEF39193.1| Reticuline oxidase precursor, putative [Ricinus communis] Length = 548 Score = 93.6 bits (231), Expect = 2e-17 Identities = 41/70 (58%), Positives = 58/70 (82%) Frame = -3 Query: 426 SSYVNYKDLELGMNRDIETSYLEASVWGKLYFKNNFERLAFVKSKVDPENFFWNEQSIPP 247 ++YVNY+DL+LGMN++ TS+++AS WG YFK+NF RL VK+KVDP+NFF +EQSIPP Sbjct: 471 TAYVNYRDLDLGMNKNSSTSFIQASAWGSKYFKDNFNRLVQVKTKVDPDNFFRHEQSIPP 530 Query: 246 LLSSGKRGKK 217 L +S +R ++ Sbjct: 531 LPASLRRKRR 540 >ref|XP_002538825.1| Reticuline oxidase precursor, putative [Ricinus communis] gi|223510249|gb|EEF23558.1| Reticuline oxidase precursor, putative [Ricinus communis] Length = 326 Score = 93.6 bits (231), Expect = 2e-17 Identities = 41/70 (58%), Positives = 58/70 (82%) Frame = -3 Query: 426 SSYVNYKDLELGMNRDIETSYLEASVWGKLYFKNNFERLAFVKSKVDPENFFWNEQSIPP 247 ++YVNY+DL+LGMN++ TS+++AS WG YFK+NF RL VK+KVDP+NFF +EQSIPP Sbjct: 249 TAYVNYRDLDLGMNKNSSTSFIQASAWGSKYFKDNFNRLVQVKTKVDPDNFFRHEQSIPP 308 Query: 246 LLSSGKRGKK 217 L +S +R ++ Sbjct: 309 LPASLRRKRR 318 >ref|XP_002317090.1| predicted protein [Populus trichocarpa] gi|222860155|gb|EEE97702.1| predicted protein [Populus trichocarpa] Length = 530 Score = 92.4 bits (228), Expect = 3e-17 Identities = 41/61 (67%), Positives = 51/61 (83%) Frame = -3 Query: 426 SSYVNYKDLELGMNRDIETSYLEASVWGKLYFKNNFERLAFVKSKVDPENFFWNEQSIPP 247 ++YVNY+DL+LGMN+ TS+ EASVWG YFK+NF RL VK+KVDP+NFF +EQSIPP Sbjct: 464 TAYVNYRDLDLGMNKKTNTSFKEASVWGTKYFKDNFRRLGLVKTKVDPDNFFRHEQSIPP 523 Query: 246 L 244 L Sbjct: 524 L 524