BLASTX nr result
ID: Coptis23_contig00026990
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00026990 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_189380.1| putative uracil phosphoribosyltransferase [Arab... 69 4e-10 ref|XP_002875388.1| predicted protein [Arabidopsis lyrata subsp.... 69 4e-10 ref|XP_002271589.2| PREDICTED: uridine kinase-like protein 5 [Vi... 68 9e-10 ref|XP_002509535.1| Uracil phosphoribosyltransferase, putative [... 66 3e-09 ref|XP_001755689.1| predicted protein [Physcomitrella patens sub... 66 3e-09 >ref|NP_189380.1| putative uracil phosphoribosyltransferase [Arabidopsis thaliana] gi|75311569|sp|Q9LTY6.1|UKL5_ARATH RecName: Full=Uridine kinase-like protein 5; Includes: RecName: Full=Probable uridine kinase; Short=UK; Includes: RecName: Full=Probable uracil phosphoribosyltransferase; Short=UPRTase; AltName: Full=UMP pyrophosphorylase gi|7939517|dbj|BAA95720.1| uridine kinase-like protein [Arabidopsis thaliana] gi|332643800|gb|AEE77321.1| putative uracil phosphoribosyltransferase [Arabidopsis thaliana] Length = 465 Score = 68.9 bits (167), Expect = 4e-10 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -3 Query: 281 GIHTVCKKFPILTLVTSEIDISQEKESHVFPGIGEFADRYFGT 153 GIH +CKKFP+L +VTSEID S ++S V PG+GEFADRYFGT Sbjct: 405 GIHALCKKFPMLKIVTSEIDSSLNEDSRVIPGLGEFADRYFGT 447 >ref|XP_002875388.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297321226|gb|EFH51647.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 464 Score = 68.9 bits (167), Expect = 4e-10 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -3 Query: 281 GIHTVCKKFPILTLVTSEIDISQEKESHVFPGIGEFADRYFGT 153 GIH +CKKFP+L +VTSEID S ++S V PG+GEFADRYFGT Sbjct: 405 GIHALCKKFPMLKIVTSEIDASLNEDSRVIPGMGEFADRYFGT 447 >ref|XP_002271589.2| PREDICTED: uridine kinase-like protein 5 [Vitis vinifera] gi|296087584|emb|CBI34840.3| unnamed protein product [Vitis vinifera] Length = 448 Score = 67.8 bits (164), Expect = 9e-10 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -3 Query: 281 GIHTVCKKFPILTLVTSEIDISQEKESHVFPGIGEFADRYFGT 153 GIH VCKKFP L +VTSEID+S K+ V PG+GEF DRYFGT Sbjct: 405 GIHAVCKKFPTLKIVTSEIDMSLNKDLRVIPGMGEFGDRYFGT 447 >ref|XP_002509535.1| Uracil phosphoribosyltransferase, putative [Ricinus communis] gi|223549434|gb|EEF50922.1| Uracil phosphoribosyltransferase, putative [Ricinus communis] Length = 481 Score = 66.2 bits (160), Expect = 3e-09 Identities = 29/43 (67%), Positives = 34/43 (79%) Frame = -3 Query: 281 GIHTVCKKFPILTLVTSEIDISQEKESHVFPGIGEFADRYFGT 153 GIH VCKKFP L +VTSEID++ +E V PG+GEF DRYFGT Sbjct: 437 GIHCVCKKFPSLKIVTSEIDVALNEEFRVIPGMGEFGDRYFGT 479 >ref|XP_001755689.1| predicted protein [Physcomitrella patens subsp. patens] gi|162693008|gb|EDQ79362.1| predicted protein [Physcomitrella patens subsp. patens] Length = 473 Score = 65.9 bits (159), Expect = 3e-09 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = -3 Query: 281 GIHTVCKKFPILTLVTSEIDISQEKESHVFPGIGEFADRYFGT 153 GIHTVCK+FP+L +VTSEID E V PG+GEF DRYFGT Sbjct: 407 GIHTVCKRFPLLKIVTSEIDAGLNDEFRVVPGMGEFGDRYFGT 449