BLASTX nr result
ID: Coptis23_contig00026910
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00026910 (323 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN61197.1| hypothetical protein VITISV_028348 [Vitis vinifera] 59 4e-07 >emb|CAN61197.1| hypothetical protein VITISV_028348 [Vitis vinifera] Length = 114 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +3 Query: 189 FVVMERLNSKLLLQNCYMIQENERLRKKAQV 281 F+VMERLNSKL LQNCY+IQENERLRKKAQ+ Sbjct: 35 FIVMERLNSKLYLQNCYIIQENERLRKKAQL 65