BLASTX nr result
ID: Coptis23_contig00026666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00026666 (228 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003617724.1| Pentatricopeptide repeat-containing protein ... 65 8e-09 gb|ABD96889.1| hypothetical protein [Cleome spinosa] 62 5e-08 emb|CBI26162.3| unnamed protein product [Vitis vinifera] 60 1e-07 ref|XP_004155892.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 ref|XP_004134313.1| PREDICTED: pentatricopeptide repeat-containi... 57 2e-06 >ref|XP_003617724.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355519059|gb|AET00683.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 861 Score = 64.7 bits (156), Expect = 8e-09 Identities = 35/74 (47%), Positives = 45/74 (60%) Frame = +1 Query: 1 PDSRCCNVVFDVLVQAKASKVAKMLIGDMDFVPDIGSLELFVVCLCEDGDVDEGFEFFLY 180 PD CN +FD LV A A K AK L+ DFVP SLE +V L E+G V+E F+ F+ Sbjct: 95 PDQSSCNALFDALVDAGAVKAAKSLLEYPDFVPKNDSLEGYVRLLGENGMVEEVFDVFVS 154 Query: 181 LRKAGYVPSLGVCN 222 L+K G++PS N Sbjct: 155 LKKVGFLPSASSFN 168 >gb|ABD96889.1| hypothetical protein [Cleome spinosa] Length = 719 Score = 62.0 bits (149), Expect = 5e-08 Identities = 30/76 (39%), Positives = 46/76 (60%) Frame = +1 Query: 1 PDSRCCNVVFDVLVQAKASKVAKMLIGDMDFVPDIGSLELFVVCLCEDGDVDEGFEFFLY 180 PD N++F+ L+ AKA + AKM+ F+PD SLE +V CLC G ++E E + Sbjct: 122 PDPISSNMLFEALLDAKAVRAAKMVRDIAGFIPDSASLEQYVKCLCGVGFIEEAIEVYFQ 181 Query: 181 LRKAGYVPSLGVCNNM 228 L++AG S+ CN++ Sbjct: 182 LKEAGIRISIVACNSI 197 >emb|CBI26162.3| unnamed protein product [Vitis vinifera] Length = 636 Score = 60.5 bits (145), Expect = 1e-07 Identities = 30/76 (39%), Positives = 42/76 (55%) Frame = +1 Query: 1 PDSRCCNVVFDVLVQAKASKVAKMLIGDMDFVPDIGSLELFVVCLCEDGDVDEGFEFFLY 180 PDS CNV+FD LV+A A AK + +F P SLE ++ CLC+ G V+E F Sbjct: 158 PDSSSCNVLFDALVEAGACNAAKSFLDSTNFNPKPASLEAYIRCLCKGGLVEEAISVFGQ 217 Query: 181 LRKAGYVPSLGVCNNM 228 L+ G S+ N++ Sbjct: 218 LKGIGVCASIATWNSV 233 >ref|XP_004155892.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18950-like [Cucumis sativus] Length = 638 Score = 56.6 bits (135), Expect = 2e-06 Identities = 29/74 (39%), Positives = 42/74 (56%) Frame = +1 Query: 1 PDSRCCNVVFDVLVQAKASKVAKMLIGDMDFVPDIGSLELFVVCLCEDGDVDEGFEFFLY 180 P CN +FD L++AKA AK + +F P+ SLE ++ C+CE G V+E F Sbjct: 157 PHPVSCNKLFDALLEAKACVPAKSFLYSFEFSPEPASLENYIRCVCEGGLVEEAVYTFDM 216 Query: 181 LRKAGYVPSLGVCN 222 L++AGY P + N Sbjct: 217 LKEAGYRPYVETWN 230 >ref|XP_004134313.1| PREDICTED: pentatricopeptide repeat-containing protein At5g18950-like [Cucumis sativus] Length = 602 Score = 56.6 bits (135), Expect = 2e-06 Identities = 29/74 (39%), Positives = 42/74 (56%) Frame = +1 Query: 1 PDSRCCNVVFDVLVQAKASKVAKMLIGDMDFVPDIGSLELFVVCLCEDGDVDEGFEFFLY 180 P CN +FD L++AKA AK + +F P+ SLE ++ C+CE G V+E F Sbjct: 121 PHPVSCNKLFDALLEAKACVPAKSFLYSFEFSPEPASLENYIRCVCEGGLVEEAVYTFDM 180 Query: 181 LRKAGYVPSLGVCN 222 L++AGY P + N Sbjct: 181 LKEAGYRPYVETWN 194