BLASTX nr result
ID: Coptis23_contig00026576
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00026576 (251 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002324024.1| oxidoreductase, 2OG-Fe(II) oxygenase family ... 79 4e-13 ref|XP_002517437.1| prolyl 4-hydroxylase alpha subunit, putative... 78 8e-13 gb|AAT84604.1| prolyl 4-hydroxylase [Dianthus caryophyllus] 77 1e-12 ref|XP_002281420.1| PREDICTED: prolyl 4-hydroxylase subunit alph... 77 2e-12 ref|XP_004168311.1| PREDICTED: prolyl 4-hydroxylase subunit alph... 75 5e-12 >ref|XP_002324024.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Populus trichocarpa] gi|222867026|gb|EEF04157.1| oxidoreductase, 2OG-Fe(II) oxygenase family protein [Populus trichocarpa] Length = 308 Score = 79.0 bits (193), Expect = 4e-13 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = +3 Query: 6 GKCVDENANCPQWAASGECQKNPVYMVGSKGAIGYCRKSCNLC 134 G C+DEN NCP WA +GECQKNPVYMVGS+G+ G CRKSC +C Sbjct: 264 GGCIDENENCPLWAKAGECQKNPVYMVGSEGSYGSCRKSCKVC 306 >ref|XP_002517437.1| prolyl 4-hydroxylase alpha subunit, putative [Ricinus communis] gi|223543448|gb|EEF44979.1| prolyl 4-hydroxylase alpha subunit, putative [Ricinus communis] Length = 311 Score = 77.8 bits (190), Expect = 8e-13 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = +3 Query: 3 RGKCVDENANCPQWAASGECQKNPVYMVGSKGAIGYCRKSCNLC 134 +G CVDEN +CP WA +GEC+KNP+YM+GS GA GYCRKSC +C Sbjct: 266 KGDCVDENDHCPLWAKAGECKKNPLYMIGSGGANGYCRKSCKVC 309 >gb|AAT84604.1| prolyl 4-hydroxylase [Dianthus caryophyllus] Length = 316 Score = 77.0 bits (188), Expect = 1e-12 Identities = 31/43 (72%), Positives = 36/43 (83%) Frame = +3 Query: 6 GKCVDENANCPQWAASGECQKNPVYMVGSKGAIGYCRKSCNLC 134 G CVD+NA C QWA +GEC+KNP+YMVGSK GYCRKSCN+C Sbjct: 274 GDCVDDNALCAQWALAGECKKNPLYMVGSKDMKGYCRKSCNVC 316 >ref|XP_002281420.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-1 [Vitis vinifera] gi|296087745|emb|CBI35001.3| unnamed protein product [Vitis vinifera] Length = 316 Score = 76.6 bits (187), Expect = 2e-12 Identities = 29/44 (65%), Positives = 39/44 (88%) Frame = +3 Query: 3 RGKCVDENANCPQWAASGECQKNPVYMVGSKGAIGYCRKSCNLC 134 +G+CVDE+ +CP+WAA GEC+KNPVYMVGS+ + G+CRKSC +C Sbjct: 271 QGECVDEDEHCPKWAAVGECEKNPVYMVGSENSDGFCRKSCGVC 314 >ref|XP_004168311.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-2-like [Cucumis sativus] Length = 313 Score = 75.1 bits (183), Expect = 5e-12 Identities = 31/44 (70%), Positives = 33/44 (75%) Frame = +3 Query: 3 RGKCVDENANCPQWAASGECQKNPVYMVGSKGAIGYCRKSCNLC 134 R CVDEN NC WA GEC+KNP YMVGS GA+GYCRKSC C Sbjct: 270 RQGCVDENENCLAWAKKGECKKNPTYMVGSGGALGYCRKSCKAC 313