BLASTX nr result
ID: Coptis23_contig00025664
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00025664 (701 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513096.1| conserved hypothetical protein [Ricinus comm... 117 2e-24 ref|XP_003588305.1| hypothetical protein MTR_1g005670 [Medicago ... 73 5e-11 ref|XP_002531736.1| conserved hypothetical protein [Ricinus comm... 58 2e-06 >ref|XP_002513096.1| conserved hypothetical protein [Ricinus communis] gi|223548107|gb|EEF49599.1| conserved hypothetical protein [Ricinus communis] Length = 813 Score = 117 bits (293), Expect = 2e-24 Identities = 55/59 (93%), Positives = 56/59 (94%) Frame = +1 Query: 511 GRRGPGCASDRHIHRGVVARVSRPGILHLAFMISTFNCAPETRSKHARPVCFFHDMLWS 687 GRRGPGCASDRH+ GVVARVSRPGILHLAFMISTF CAPETRSKHARPVCFFHDMLWS Sbjct: 742 GRRGPGCASDRHM--GVVARVSRPGILHLAFMISTFRCAPETRSKHARPVCFFHDMLWS 798 >ref|XP_003588305.1| hypothetical protein MTR_1g005670 [Medicago truncatula] gi|355477353|gb|AES58556.1| hypothetical protein MTR_1g005670 [Medicago truncatula] Length = 250 Score = 73.2 bits (178), Expect = 5e-11 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = +1 Query: 604 MISTFNCAPETRSKHARPVCFFHDMLWSRVSS 699 MISTFNCAPETRSKHARPVCFFHDMLWSRVSS Sbjct: 1 MISTFNCAPETRSKHARPVCFFHDMLWSRVSS 32 >ref|XP_002531736.1| conserved hypothetical protein [Ricinus communis] gi|223528639|gb|EEF30656.1| conserved hypothetical protein [Ricinus communis] Length = 74 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/41 (68%), Positives = 31/41 (75%) Frame = -1 Query: 266 DRGLVVPASAAMQWKGRSLNRPPSFFLFKDTKAVP*DWTLR 144 DRGL+VPASAAMQWKGRSLNRPPSFF K + D +R Sbjct: 26 DRGLIVPASAAMQWKGRSLNRPPSFFSKKKSSTKRLDSRMR 66