BLASTX nr result
ID: Coptis23_contig00025633
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00025633 (330 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003604154.1| Ycf68 protein [Medicago truncatula] gi|35550... 114 1e-23 ref|XP_003599576.1| Ycf68 protein [Medicago truncatula] gi|35548... 114 1e-23 ref|YP_636345.1| hypothetical protein EuglglCp070 [Eucalyptus gl... 96 2e-18 ref|ZP_01976988.1| hypothetical protein A5E_B0095 [Vibrio choler... 87 2e-15 ref|YP_003540978.1| hypothetical chloroplast RF68 [Phoenix dacty... 65 1e-12 >ref|XP_003604154.1| Ycf68 protein [Medicago truncatula] gi|355505209|gb|AES86351.1| Ycf68 protein [Medicago truncatula] Length = 237 Score = 114 bits (284), Expect = 1e-23 Identities = 59/81 (72%), Positives = 61/81 (75%) Frame = +3 Query: 87 RALSHMDSSMCSSAPDPEMWIIQGTLAWRTPPVRTGV*NQISPQEDRWGDSGEIQCRSNF 266 RALSH+DSSMCSSAPDPEMWIIQGTL EDRWGDSGEIQCRSNF Sbjct: 119 RALSHIDSSMCSSAPDPEMWIIQGTL------------------EDRWGDSGEIQCRSNF 160 Query: 267 LFTRGIRAVRGGPPRLLSSRE 329 LFTRGIRAV+GGP LLSSRE Sbjct: 161 LFTRGIRAVQGGPSWLLSSRE 181 >ref|XP_003599576.1| Ycf68 protein [Medicago truncatula] gi|355488624|gb|AES69827.1| Ycf68 protein [Medicago truncatula] Length = 237 Score = 114 bits (284), Expect = 1e-23 Identities = 59/81 (72%), Positives = 61/81 (75%) Frame = +3 Query: 87 RALSHMDSSMCSSAPDPEMWIIQGTLAWRTPPVRTGV*NQISPQEDRWGDSGEIQCRSNF 266 RALSH+DSSMCSSAPDPEMWIIQGTL EDRWGDSGEIQCRSNF Sbjct: 119 RALSHIDSSMCSSAPDPEMWIIQGTL------------------EDRWGDSGEIQCRSNF 160 Query: 267 LFTRGIRAVRGGPPRLLSSRE 329 LFTRGIRAV+GGP LLSSRE Sbjct: 161 LFTRGIRAVQGGPSWLLSSRE 181 >ref|YP_636345.1| hypothetical protein EuglglCp070 [Eucalyptus globulus subsp. globulus] gi|108802701|ref|YP_636358.1| hypothetical protein EuglglCp084 [Eucalyptus globulus subsp. globulus] gi|122219157|sp|Q49KT9.1|YCF68_EUCGG RecName: Full=Uncharacterized protein ycf68; AltName: Full=ORF113 gi|60460854|gb|AAX21074.1| hypothetical protein [Eucalyptus globulus subsp. globulus] gi|60460867|gb|AAX21087.1| hypothetical protein [Eucalyptus globulus subsp. globulus] Length = 113 Score = 96.3 bits (238), Expect = 2e-18 Identities = 50/67 (74%), Positives = 52/67 (77%) Frame = +3 Query: 63 LRRCAWAVRALSHMDSSMCSSAPDPEMWIIQGTLAWRTPPVRTGV*NQISPQEDRWGDSG 242 +RRCAWAVRALSHMDSSMCSSAPDPEMWIIQGTLAWRT PVRTG + P R G Sbjct: 1 MRRCAWAVRALSHMDSSMCSSAPDPEMWIIQGTLAWRTSPVRTGF--ETKPLLRR--IDG 56 Query: 243 EIQCRSN 263 IQ RSN Sbjct: 57 AIQVRSN 63 Score = 83.2 bits (204), Expect = 2e-14 Identities = 42/45 (93%), Positives = 42/45 (93%) Frame = +1 Query: 196 FETKFLLRRIDGAIQVRSNVDPTFYSLVGSGRSGGDHQGSSLLEN 330 FETK LLRRIDGAIQVRSNVDPTFYSLVGSGRSGGD GSSLLEN Sbjct: 45 FETKPLLRRIDGAIQVRSNVDPTFYSLVGSGRSGGDPHGSSLLEN 89 >ref|ZP_01976988.1| hypothetical protein A5E_B0095 [Vibrio cholerae B33] gi|126518156|gb|EAZ75381.1| hypothetical protein A5E_B0095 [Vibrio cholerae B33] Length = 42 Score = 86.7 bits (213), Expect = 2e-15 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = -3 Query: 160 VPWMIHISGSGADEHIELSMWLRALTAQAQRRNYQGRALPLS 35 +PWMIHI GSGADEHIELSMWLRALTAQAQRRNYQGRALPLS Sbjct: 1 MPWMIHIPGSGADEHIELSMWLRALTAQAQRRNYQGRALPLS 42 >ref|YP_003540978.1| hypothetical chloroplast RF68 [Phoenix dactylifera] gi|292559577|ref|YP_003540992.1| hypothetical chloroplast RF68 [Phoenix dactylifera] gi|377819425|ref|YP_005097920.1| hypothetical protein ycf68 (chloroplast) [Colocasia esculenta] gi|377819438|ref|YP_005097933.1| hypothetical protein ycf68 (chloroplast) [Colocasia esculenta] gi|294620624|gb|ADF28193.1| hypothetical chloroplast RF68 (chloroplast) [Phoenix dactylifera] gi|294620638|gb|ADF28207.1| hypothetical chloroplast RF68 (chloroplast) [Phoenix dactylifera] gi|340536686|gb|AEK48453.1| hypothetical protein ycf68 (chloroplast) [Colocasia esculenta] gi|340536699|gb|AEK48466.1| hypothetical protein ycf68 (chloroplast) [Colocasia esculenta] gi|340536773|gb|AEK48539.1| hypothetical protein ycf68 (chloroplast) [Colocasia esculenta] gi|340536786|gb|AEK48552.1| hypothetical protein ycf68 (chloroplast) [Colocasia esculenta] Length = 114 Score = 64.7 bits (156), Expect(2) = 1e-12 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +3 Query: 237 SGEIQCRSNFLFTRGIRAVRGGPPRLLSSRE 329 +GEIQCRSNFLFTRGIRAVRGGPPRLLSSRE Sbjct: 14 NGEIQCRSNFLFTRGIRAVRGGPPRLLSSRE 44 Score = 33.1 bits (74), Expect(2) = 1e-12 Identities = 14/14 (100%), Positives = 14/14 (100%) Frame = +2 Query: 167 MAYSSCSNRSLKPN 208 MAYSSCSNRSLKPN Sbjct: 1 MAYSSCSNRSLKPN 14