BLASTX nr result
ID: Coptis23_contig00025625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00025625 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004135442.1| PREDICTED: anthocyanidin 5,3-O-glucosyltrans... 95 5e-18 ref|XP_002306046.1| predicted protein [Populus trichocarpa] gi|2... 94 1e-17 ref|XP_003614003.1| hypothetical protein MTR_5g043630 [Medicago ... 90 2e-16 ref|XP_003607777.1| Anthocyanidin 5 3-O-glucosyltransferase [Med... 82 4e-14 ref|XP_003607776.1| UDP-glucosyltransferase [Medicago truncatula... 79 3e-13 >ref|XP_004135442.1| PREDICTED: anthocyanidin 5,3-O-glucosyltransferase-like [Cucumis sativus] gi|449530181|ref|XP_004172074.1| PREDICTED: anthocyanidin 5,3-O-glucosyltransferase-like [Cucumis sativus] Length = 458 Score = 95.1 bits (235), Expect = 5e-18 Identities = 43/70 (61%), Positives = 56/70 (80%) Frame = +2 Query: 71 HIALLPSSGMGHLTPFLRLASSLLHQNYQLTFITTYPTVSHSETQLISKFLSTYPQVTSK 250 H+AL PS+GMGHL PFLRLA++LL N +LT IT++P VS +E+ LIS+FLS +PQV Sbjct: 9 HVALFPSAGMGHLVPFLRLANTLLSHNCKLTLITSHPPVSSAESHLISRFLSAFPQVNEL 68 Query: 251 QFHLLPFDPS 280 +FH+LP DPS Sbjct: 69 KFHILPLDPS 78 >ref|XP_002306046.1| predicted protein [Populus trichocarpa] gi|222849010|gb|EEE86557.1| predicted protein [Populus trichocarpa] Length = 461 Score = 94.0 bits (232), Expect = 1e-17 Identities = 43/68 (63%), Positives = 56/68 (82%) Frame = +2 Query: 71 HIALLPSSGMGHLTPFLRLASSLLHQNYQLTFITTYPTVSHSETQLISKFLSTYPQVTSK 250 H+ALLPS+GMGHLTPFLRLA+SL QN Q+TFI +PTVS SE+Q +S+ +++PQ+ + Sbjct: 11 HVALLPSAGMGHLTPFLRLAASLTLQNVQVTFIIPHPTVSLSESQALSQLFASFPQIKHQ 70 Query: 251 QFHLLPFD 274 QFHLLP D Sbjct: 71 QFHLLPLD 78 >ref|XP_003614003.1| hypothetical protein MTR_5g043630 [Medicago truncatula] gi|355515338|gb|AES96961.1| hypothetical protein MTR_5g043630 [Medicago truncatula] Length = 205 Score = 89.7 bits (221), Expect = 2e-16 Identities = 44/67 (65%), Positives = 50/67 (74%) Frame = +2 Query: 71 HIALLPSSGMGHLTPFLRLASSLLHQNYQLTFITTYPTVSHSETQLISKFLSTYPQVTSK 250 H+ALLPSSGMGHLTPFLRLAS LL +T IT PTV+ +E ISKF S++PQV Sbjct: 8 HVALLPSSGMGHLTPFLRLASLLLQHQCHVTLITPQPTVTKAEEDFISKFHSSFPQVNRV 67 Query: 251 QFHLLPF 271 QFHLLPF Sbjct: 68 QFHLLPF 74 >ref|XP_003607777.1| Anthocyanidin 5 3-O-glucosyltransferase [Medicago truncatula] gi|355508832|gb|AES89974.1| Anthocyanidin 5 3-O-glucosyltransferase [Medicago truncatula] Length = 469 Score = 82.0 bits (201), Expect = 4e-14 Identities = 39/69 (56%), Positives = 50/69 (72%) Frame = +2 Query: 71 HIALLPSSGMGHLTPFLRLASSLLHQNYQLTFITTYPTVSHSETQLISKFLSTYPQVTSK 250 H+A+ PS+GMGHLTPFLRLAS L+ N ++T IT PTVS +E+QL+ F S++PQV Sbjct: 7 HVAMFPSAGMGHLTPFLRLASLFLNNNCKVTLITPLPTVSLAESQLLDHFHSSFPQVNFI 66 Query: 251 QFHLLPFDP 277 FHL P P Sbjct: 67 PFHLQPSSP 75 >ref|XP_003607776.1| UDP-glucosyltransferase [Medicago truncatula] gi|355508831|gb|AES89973.1| UDP-glucosyltransferase [Medicago truncatula] Length = 411 Score = 79.3 bits (194), Expect = 3e-13 Identities = 39/70 (55%), Positives = 50/70 (71%) Frame = +2 Query: 71 HIALLPSSGMGHLTPFLRLASSLLHQNYQLTFITTYPTVSHSETQLISKFLSTYPQVTSK 250 H+A+ PS+GMGHLTPFLRLAS L+ N ++T IT PTVS +E+QL+ F S +PQV Sbjct: 7 HVAMFPSAGMGHLTPFLRLASLFLNNNCKVTLITPLPTVSLAESQLLDHFHSCFPQVNRV 66 Query: 251 QFHLLPFDPS 280 F+L P PS Sbjct: 67 PFNLPPPPPS 76