BLASTX nr result
ID: Coptis23_contig00025471
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00025471 (234 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003633563.1| PREDICTED: tRNA-dihydrouridine synthase A-li... 71 1e-10 emb|CBI24913.3| unnamed protein product [Vitis vinifera] 71 1e-10 ref|XP_002277955.1| PREDICTED: tRNA-dihydrouridine synthase A-li... 71 1e-10 ref|XP_002517816.1| tRNA-dihydrouridine synthase A, putative [Ri... 70 2e-10 ref|XP_002314040.1| predicted protein [Populus trichocarpa] gi|2... 68 7e-10 >ref|XP_003633563.1| PREDICTED: tRNA-dihydrouridine synthase A-like isoform 2 [Vitis vinifera] Length = 377 Score = 70.9 bits (172), Expect = 1e-10 Identities = 30/39 (76%), Positives = 37/39 (94%) Frame = -2 Query: 137 DFVYTVASQSPTKHFVIHARKALLNGISPAANRKVPPLQ 21 DF+Y V+SQSPT+HF+IH+RKALLNGISPA NRK+PPL+ Sbjct: 156 DFIYKVSSQSPTRHFIIHSRKALLNGISPADNRKIPPLK 194 >emb|CBI24913.3| unnamed protein product [Vitis vinifera] Length = 423 Score = 70.9 bits (172), Expect = 1e-10 Identities = 30/39 (76%), Positives = 37/39 (94%) Frame = -2 Query: 137 DFVYTVASQSPTKHFVIHARKALLNGISPAANRKVPPLQ 21 DF+Y V+SQSPT+HF+IH+RKALLNGISPA NRK+PPL+ Sbjct: 202 DFIYKVSSQSPTRHFIIHSRKALLNGISPADNRKIPPLK 240 >ref|XP_002277955.1| PREDICTED: tRNA-dihydrouridine synthase A-like isoform 1 [Vitis vinifera] Length = 433 Score = 70.9 bits (172), Expect = 1e-10 Identities = 30/39 (76%), Positives = 37/39 (94%) Frame = -2 Query: 137 DFVYTVASQSPTKHFVIHARKALLNGISPAANRKVPPLQ 21 DF+Y V+SQSPT+HF+IH+RKALLNGISPA NRK+PPL+ Sbjct: 212 DFIYKVSSQSPTRHFIIHSRKALLNGISPADNRKIPPLK 250 >ref|XP_002517816.1| tRNA-dihydrouridine synthase A, putative [Ricinus communis] gi|223543088|gb|EEF44623.1| tRNA-dihydrouridine synthase A, putative [Ricinus communis] Length = 375 Score = 69.7 bits (169), Expect = 2e-10 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -2 Query: 137 DFVYTVASQSPTKHFVIHARKALLNGISPAANRKVPPLQ 21 DF+Y V+S SPTKHF+IH+RKALLNGISPA NRK+PPL+ Sbjct: 156 DFIYKVSSLSPTKHFIIHSRKALLNGISPAENRKIPPLK 194 >ref|XP_002314040.1| predicted protein [Populus trichocarpa] gi|222850448|gb|EEE87995.1| predicted protein [Populus trichocarpa] Length = 380 Score = 68.2 bits (165), Expect = 7e-10 Identities = 29/39 (74%), Positives = 36/39 (92%) Frame = -2 Query: 137 DFVYTVASQSPTKHFVIHARKALLNGISPAANRKVPPLQ 21 DF+Y V+S SPTKHF+IH+RKALLNGISPA NR++PPL+ Sbjct: 156 DFIYKVSSLSPTKHFIIHSRKALLNGISPADNRRIPPLK 194