BLASTX nr result
ID: Coptis23_contig00025393
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00025393 (460 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517183.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 ref|XP_002280710.1| PREDICTED: uncharacterized protein LOC100261... 58 7e-07 >ref|XP_002517183.1| conserved hypothetical protein [Ricinus communis] gi|223543818|gb|EEF45346.1| conserved hypothetical protein [Ricinus communis] Length = 453 Score = 60.1 bits (144), Expect = 2e-07 Identities = 30/67 (44%), Positives = 45/67 (67%), Gaps = 5/67 (7%) Frame = -1 Query: 193 MSYFEVLKKFKR---FEPAS--LAFFVITVFAFLCCFFYLDYRVVVSKGFQYNGQGQQRF 29 M FE+ KKFKR FEP+ L FF++TV +CCFFY D+R ++KG++ G+ +R+ Sbjct: 13 MQVFEIFKKFKRLRLFEPSVGVLGFFLVTV-CVICCFFYFDFRDAITKGYKVPGK-SERY 70 Query: 28 LWLGFED 8 +WL F + Sbjct: 71 MWLQFNE 77 >ref|XP_002280710.1| PREDICTED: uncharacterized protein LOC100261302 [Vitis vinifera] gi|297736996|emb|CBI26197.3| unnamed protein product [Vitis vinifera] Length = 446 Score = 58.2 bits (139), Expect = 7e-07 Identities = 32/65 (49%), Positives = 44/65 (67%), Gaps = 5/65 (7%) Frame = -1 Query: 193 MSYFEVLKKFKRF---EPAS--LAFFVITVFAFLCCFFYLDYRVVVSKGFQYNGQGQQRF 29 + +F+V KKFKRF EP+ L FF +TV + +CCFFYLDYR +KGF ++ Q +RF Sbjct: 13 LPFFDVFKKFKRFRLLEPSVGVLGFFFVTV-SVICCFFYLDYR-AAAKGFLFSSQ-SERF 69 Query: 28 LWLGF 14 +W F Sbjct: 70 MWFRF 74