BLASTX nr result
ID: Coptis23_contig00025246
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00025246 (239 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521510.1| 50S ribosomal protein L7/L12, putative [Rici... 60 2e-07 ref|XP_004149984.1| PREDICTED: 54S ribosomal protein L12, mitoch... 59 3e-07 ref|XP_002310275.1| predicted protein [Populus trichocarpa] gi|2... 59 3e-07 ref|XP_002867017.1| ribosomal protein L12 family protein [Arabid... 58 7e-07 ref|NP_195360.1| Ribosomal protein L12 family protein [Arabidops... 58 7e-07 >ref|XP_002521510.1| 50S ribosomal protein L7/L12, putative [Ricinus communis] gi|223539188|gb|EEF40781.1| 50S ribosomal protein L7/L12, putative [Ricinus communis] Length = 192 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 238 KDLVEKAPTLLKKGVTKEEAQKIIDKMKEIGAK 140 KDLVEKAPTLLKKGVTKEEA+KI KMKE+GAK Sbjct: 156 KDLVEKAPTLLKKGVTKEEAEKITAKMKEVGAK 188 >ref|XP_004149984.1| PREDICTED: 54S ribosomal protein L12, mitochondrial-like [Cucumis sativus] gi|449491404|ref|XP_004158886.1| PREDICTED: 54S ribosomal protein L12, mitochondrial-like isoform 1 [Cucumis sativus] gi|449491408|ref|XP_004158887.1| PREDICTED: 54S ribosomal protein L12, mitochondrial-like isoform 2 [Cucumis sativus] Length = 202 Score = 59.3 bits (142), Expect = 3e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 238 KDLVEKAPTLLKKGVTKEEAQKIIDKMKEIGAK 140 KDLVEKAPTLLKKGVTKEEA+ II KMKE+GAK Sbjct: 166 KDLVEKAPTLLKKGVTKEEAETIIAKMKEVGAK 198 >ref|XP_002310275.1| predicted protein [Populus trichocarpa] gi|222853178|gb|EEE90725.1| predicted protein [Populus trichocarpa] Length = 147 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -2 Query: 238 KDLVEKAPTLLKKGVTKEEAQKIIDKMKEIGAK 140 KDLVEKAPTLLKKGVTK+EA+KII+KMK +GAK Sbjct: 111 KDLVEKAPTLLKKGVTKDEAEKIIEKMKGVGAK 143 >ref|XP_002867017.1| ribosomal protein L12 family protein [Arabidopsis lyrata subsp. lyrata] gi|297312853|gb|EFH43276.1| ribosomal protein L12 family protein [Arabidopsis lyrata subsp. lyrata] Length = 179 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -2 Query: 238 KDLVEKAPTLLKKGVTKEEAQKIIDKMKEIGAK 140 KDLVEKAPTLLKKGV+KEEA+KII+K+K +GAK Sbjct: 143 KDLVEKAPTLLKKGVSKEEAEKIIEKLKAVGAK 175 >ref|NP_195360.1| Ribosomal protein L12 family protein [Arabidopsis thaliana] gi|13878063|gb|AAK44109.1|AF370294_1 putative ribosomal protein [Arabidopsis thaliana] gi|4006919|emb|CAB16813.1| ribosomal protein [Arabidopsis thaliana] gi|7270590|emb|CAB80308.1| ribosomal protein [Arabidopsis thaliana] gi|15450415|gb|AAK96501.1| At4g36420/C7A10_940 [Arabidopsis thaliana] gi|17104653|gb|AAL34215.1| putative ribosomal protein [Arabidopsis thaliana] gi|332661254|gb|AEE86654.1| Ribosomal protein L12 family protein [Arabidopsis thaliana] Length = 179 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/33 (81%), Positives = 32/33 (96%) Frame = -2 Query: 238 KDLVEKAPTLLKKGVTKEEAQKIIDKMKEIGAK 140 KDLVEKAPTLLKKGV+KEEA+KII+K+K +GAK Sbjct: 143 KDLVEKAPTLLKKGVSKEEAEKIIEKLKAVGAK 175