BLASTX nr result
ID: Coptis23_contig00025181
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00025181 (368 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB10337.1| reverse transcriptase like protein [Arabidopsis ... 65 7e-09 gb|ABE87589.2| RNA-directed DNA polymerase (Reverse transcriptas... 64 2e-08 ref|XP_002522932.1| conserved hypothetical protein [Ricinus comm... 60 1e-07 gb|AAD37021.1| putative non-LTR retrolelement reverse transcript... 60 2e-07 gb|AAC63844.1| putative non-LTR retroelement reverse transcripta... 60 2e-07 >emb|CAB10337.1| reverse transcriptase like protein [Arabidopsis thaliana] gi|7268307|emb|CAB78601.1| reverse transcriptase like protein [Arabidopsis thaliana] Length = 929 Score = 64.7 bits (156), Expect = 7e-09 Identities = 35/91 (38%), Positives = 51/91 (56%), Gaps = 5/91 (5%) Frame = -2 Query: 265 RNFLRTGNPATTKRITVGWDKICKPYEEGRLGIRRIKDLNRALLMKLGWRVLTQKDD-FA 89 RNFL K+ + W K+C+P G LG+R KD+NRALL K+GWR+L K +A Sbjct: 621 RNFLWGSTVEKRKQHLLSWKKVCRPKAAGGLGLRASKDMNRALLAKVGWRLLNDKVSLWA 680 Query: 88 QFMRHKYFTSD----NEMIKYHVTSSIWRGL 8 + +R KY +D + ++ SS WR + Sbjct: 681 RVLRRKYKVTDVHDSSWLVPKATWSSTWRSI 711 >gb|ABE87589.2| RNA-directed DNA polymerase (Reverse transcriptase); Ribonuclease H; Endonuclease/exonuclease/phosphatase [Medicago truncatula] Length = 1246 Score = 63.5 bits (153), Expect = 2e-08 Identities = 27/75 (36%), Positives = 46/75 (61%) Frame = -2 Query: 229 KRITVGWDKICKPYEEGRLGIRRIKDLNRALLMKLGWRVLTQKDDFAQFMRHKYFTSDNE 50 K TV W +C+P+ EG L I+ + +N A ++KL W +L+ +A ++ ++F S + Sbjct: 772 KVCTVSWKILCRPWSEGGLDIKSTRLINNAAMLKLAWNLLSSNSQWAVLLKRRFF-SQGQ 830 Query: 49 MIKYHVTSSIWRGLK 5 I+Y V SS+W G+K Sbjct: 831 PIRYFVKSSVWHGVK 845 >ref|XP_002522932.1| conserved hypothetical protein [Ricinus communis] gi|223537826|gb|EEF39443.1| conserved hypothetical protein [Ricinus communis] Length = 303 Score = 60.5 bits (145), Expect = 1e-07 Identities = 25/70 (35%), Positives = 42/70 (60%) Frame = -2 Query: 268 LRNFLRTGNPATTKRITVGWDKICKPYEEGRLGIRRIKDLNRALLMKLGWRVLTQKDDFA 89 +RNFL TG+ + K +TV W CKP EG +G++R+ LNR +L ++ W+ + Sbjct: 209 IRNFLWTGSVSYKKLVTVKWGHCCKPISEGGIGLKRLDVLNRTMLCRIAWKFYSNDSFVY 268 Query: 88 QFMRHKYFTS 59 +F+R +Y + Sbjct: 269 RFLRSRYLVA 278 >gb|AAD37021.1| putative non-LTR retrolelement reverse transcriptase [Arabidopsis thaliana] Length = 732 Score = 60.1 bits (144), Expect = 2e-07 Identities = 33/91 (36%), Positives = 50/91 (54%), Gaps = 5/91 (5%) Frame = -2 Query: 265 RNFLRTGNPATTKRITVGWDKICKPYEEGRLGIRRIKDLNRALLMKLGWRVLTQKDD-FA 89 R+FL + K+ + W ++CKP EG LGIR+ +D+N+ALL K+GWR++ +A Sbjct: 348 RSFLWGSSVTQRKQHLISWKRVCKPRSEGGLGIRKAQDMNKALLSKVGWRLIQDYHSLWA 407 Query: 88 QFMRHKYFTSDNEMIKY----HVTSSIWRGL 8 + MR Y D + V SS WR + Sbjct: 408 RIMRCNYRVQDVRDGAWTKVRSVCSSTWRSV 438 >gb|AAC63844.1| putative non-LTR retroelement reverse transcriptase [Arabidopsis thaliana] Length = 1231 Score = 59.7 bits (143), Expect = 2e-07 Identities = 34/93 (36%), Positives = 51/93 (54%), Gaps = 5/93 (5%) Frame = -2 Query: 271 FLRNFLRTGNPATTKRITVGWDKICKPYEEGRLGIRRIKDLNRALLMKLGWRVLTQKDD- 95 + R FL K+ + W KICKP EG +G+R +D+N+AL+ K+GWR+L K+ Sbjct: 684 YSRTFLWGSTMEKKKQHLLSWRKICKPKAEGGIGLRSARDMNKALVAKVGWRLLQDKESL 743 Query: 94 FAQFMRHKY---FTSDNEMIKYHVT-SSIWRGL 8 +A+ +R KY D +K SS WR + Sbjct: 744 WARVVRKKYKVGGVQDTSWLKPQPRWSSTWRSV 776