BLASTX nr result
ID: Coptis23_contig00025105
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00025105 (345 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003545609.1| PREDICTED: E3 ubiquitin-protein ligase HERC2... 57 2e-06 >ref|XP_003545609.1| PREDICTED: E3 ubiquitin-protein ligase HERC2-like [Glycine max] Length = 576 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/55 (49%), Positives = 34/55 (61%), Gaps = 2/55 (3%) Frame = -1 Query: 195 THAGDLLSAMYIMCNEYGSKFVNPIQVVCRAAHTIIVAHSEYGLWR--REQEGVV 37 TH+GD LS I CN + KF P+QV C AAHT+I+AH LW R + GV+ Sbjct: 368 THSGDALSPFLISCNPHQPKFSQPVQVACGAAHTVIIAHEGCKLWSWGRGRSGVL 422