BLASTX nr result
ID: Coptis23_contig00025025
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00025025 (240 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEX11721.1| hypothetical protein 0_16729_01 [Pinus radiata] 69 4e-10 gb|AEX11710.1| hypothetical protein 0_16729_01 [Pinus taeda] 67 1e-09 gb|AEX11708.1| hypothetical protein 0_16729_01 [Pinus taeda] gi|... 67 1e-09 gb|ABR17398.1| unknown [Picea sitchensis] 61 1e-07 ref|XP_002534135.1| Purple acid phosphatase precursor, putative ... 57 2e-06 >gb|AEX11721.1| hypothetical protein 0_16729_01 [Pinus radiata] Length = 76 Score = 68.9 bits (167), Expect = 4e-10 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -1 Query: 240 AFYSWHRNQDSEAVLGDSQWFYNRQWYPHEESSTA 136 AFY WHRNQD +AV+GDSQWFYNR WYPH E +T+ Sbjct: 41 AFYHWHRNQDGDAVVGDSQWFYNRYWYPHNEPTTS 75 >gb|AEX11710.1| hypothetical protein 0_16729_01 [Pinus taeda] Length = 76 Score = 67.4 bits (163), Expect = 1e-09 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -1 Query: 240 AFYSWHRNQDSEAVLGDSQWFYNRQWYPHEESSTAGN 130 AFY WHRNQD +AV+GDSQWFYNR WYPH E TA N Sbjct: 41 AFYHWHRNQDGDAVVGDSQWFYNRYWYPHNE-PTASN 76 >gb|AEX11708.1| hypothetical protein 0_16729_01 [Pinus taeda] gi|367062854|gb|AEX11709.1| hypothetical protein 0_16729_01 [Pinus taeda] gi|367062858|gb|AEX11711.1| hypothetical protein 0_16729_01 [Pinus taeda] gi|367062860|gb|AEX11712.1| hypothetical protein 0_16729_01 [Pinus taeda] gi|367062862|gb|AEX11713.1| hypothetical protein 0_16729_01 [Pinus taeda] gi|367062864|gb|AEX11714.1| hypothetical protein 0_16729_01 [Pinus taeda] gi|367062866|gb|AEX11715.1| hypothetical protein 0_16729_01 [Pinus taeda] gi|367062868|gb|AEX11716.1| hypothetical protein 0_16729_01 [Pinus taeda] gi|367062870|gb|AEX11717.1| hypothetical protein 0_16729_01 [Pinus taeda] gi|367062872|gb|AEX11718.1| hypothetical protein 0_16729_01 [Pinus taeda] gi|367062874|gb|AEX11719.1| hypothetical protein 0_16729_01 [Pinus taeda] gi|367062876|gb|AEX11720.1| hypothetical protein 0_16729_01 [Pinus taeda] Length = 76 Score = 67.4 bits (163), Expect = 1e-09 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = -1 Query: 240 AFYSWHRNQDSEAVLGDSQWFYNRQWYPHEESSTAGN 130 AFY WHRNQD +AV+GDSQWFYNR WYPH E TA N Sbjct: 41 AFYHWHRNQDGDAVVGDSQWFYNRYWYPHNE-PTASN 76 >gb|ABR17398.1| unknown [Picea sitchensis] Length = 151 Score = 60.8 bits (146), Expect = 1e-07 Identities = 24/34 (70%), Positives = 27/34 (79%) Frame = -1 Query: 240 AFYSWHRNQDSEAVLGDSQWFYNRQWYPHEESST 139 AFY WHRNQD +AV+GDSQW YNR YPH E +T Sbjct: 116 AFYHWHRNQDGDAVVGDSQWLYNRYSYPHNEPTT 149 >ref|XP_002534135.1| Purple acid phosphatase precursor, putative [Ricinus communis] gi|223525807|gb|EEF28252.1| Purple acid phosphatase precursor, putative [Ricinus communis] Length = 461 Score = 56.6 bits (135), Expect = 2e-06 Identities = 22/38 (57%), Positives = 25/38 (65%) Frame = -1 Query: 240 AFYSWHRNQDSEAVLGDSQWFYNRQWYPHEESSTAGNV 127 A Y+WHRNQD EAV D W YNR WYP EE S+ + Sbjct: 423 ACYTWHRNQDDEAVAADFLWIYNRYWYPEEEQSSINRI 460