BLASTX nr result
ID: Coptis23_contig00025005
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00025005 (266 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAK70407.1|AF369930_2 pol polyprotein [Citrus x paradisi] 59 5e-07 >gb|AAK70407.1|AF369930_2 pol polyprotein [Citrus x paradisi] Length = 701 Score = 58.5 bits (140), Expect = 5e-07 Identities = 35/74 (47%), Positives = 42/74 (56%), Gaps = 2/74 (2%) Frame = -2 Query: 217 AMIQIPNDNNHNRPFKFEGQNFKRWKAKMHFYLKLMKVADVL--DNPKPTDTELHEPARS 44 A + IP N+ RP KF GQNFKRW+ KM FYL + +A L D PKP + E S Sbjct: 30 ASVAIPV-NHAERPEKFNGQNFKRWQQKMFFYLTTLNLARFLTKDAPKPKEGETDIQVAS 88 Query: 43 HAIGKWEQADDLCK 2 AI W +D LCK Sbjct: 89 -AIDAWHHSDFLCK 101