BLASTX nr result
ID: Coptis23_contig00024447
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00024447 (248 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003547556.1| PREDICTED: uncharacterized protein LOC100791... 56 3e-06 >ref|XP_003547556.1| PREDICTED: uncharacterized protein LOC100791724 [Glycine max] Length = 383 Score = 56.2 bits (134), Expect = 3e-06 Identities = 30/54 (55%), Positives = 38/54 (70%), Gaps = 2/54 (3%) Frame = -1 Query: 167 NPTSSNMNSRTPTIKFSSNSQ--ENSAPSDKKSFAVATGELFLGIASRIIKRRN 12 NP SS + R I F+SNS ++ + KKSFAVATGELFLG+A+R+IK RN Sbjct: 20 NPNSSILRRRAQFISFASNSSPPQDEEATAKKSFAVATGELFLGLATRLIKSRN 73