BLASTX nr result
ID: Coptis23_contig00024303
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00024303 (450 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003632370.1| PREDICTED: cyclin-dependent kinase inhibitor... 80 1e-13 ref|XP_002464499.1| hypothetical protein SORBIDRAFT_01g019550 [S... 72 5e-11 ref|NP_001168443.1| uncharacterized protein LOC100382215 [Zea ma... 70 1e-10 ref|XP_002301783.1| kip-related cyclin-dependent kinase inhibito... 69 3e-10 ref|NP_199693.1| cyclin-dependent kinase inhibitor 3 [Arabidopsi... 69 4e-10 >ref|XP_003632370.1| PREDICTED: cyclin-dependent kinase inhibitor 3-like [Vitis vinifera] gi|297744341|emb|CBI37311.3| unnamed protein product [Vitis vinifera] Length = 218 Score = 80.1 bits (196), Expect(2) = 1e-13 Identities = 47/78 (60%), Positives = 55/78 (70%) Frame = +1 Query: 4 MGKYMRKAKITGEIAVMELATTTTTSLVSGVRTRAKTLALQRLQKTTXXXXXXXXXCYLQ 183 MGKYM+KAKITG++ VME++++ GVRTRAKTLALQRLQKTT YL+ Sbjct: 1 MGKYMKKAKITGDVTVMEVSSSL------GVRTRAKTLALQRLQKTTHQEGPKPDTSYLE 54 Query: 184 LRSRRLEKKPPSLLSGVN 237 LRSRRLEK P LLS N Sbjct: 55 LRSRRLEK--PPLLSEPN 70 Score = 21.2 bits (43), Expect(2) = 1e-13 Identities = 7/11 (63%), Positives = 9/11 (81%) Frame = +3 Query: 318 TDSNKKPNPNP 350 ++ NKK NPNP Sbjct: 67 SEPNKKQNPNP 77 >ref|XP_002464499.1| hypothetical protein SORBIDRAFT_01g019550 [Sorghum bicolor] gi|241918353|gb|EER91497.1| hypothetical protein SORBIDRAFT_01g019550 [Sorghum bicolor] Length = 191 Score = 72.0 bits (175), Expect = 5e-11 Identities = 38/72 (52%), Positives = 49/72 (68%) Frame = +1 Query: 4 MGKYMRKAKITGEIAVMELATTTTTSLVSGVRTRAKTLALQRLQKTTXXXXXXXXXCYLQ 183 MGKYMRK K++GE+A+M++++ GVRTRA+ LALQRLQK YL+ Sbjct: 1 MGKYMRKVKVSGEVAIMDVSSAPL-----GVRTRARALALQRLQKQQAQGEEGAGGEYLE 55 Query: 184 LRSRRLEKKPPS 219 LRSRRLEK PP+ Sbjct: 56 LRSRRLEKLPPT 67 >ref|NP_001168443.1| uncharacterized protein LOC100382215 [Zea mays] gi|223948339|gb|ACN28253.1| unknown [Zea mays] gi|413934057|gb|AFW68608.1| hypothetical protein ZEAMMB73_775583 [Zea mays] Length = 192 Score = 70.5 bits (171), Expect = 1e-10 Identities = 38/75 (50%), Positives = 48/75 (64%) Frame = +1 Query: 4 MGKYMRKAKITGEIAVMELATTTTTSLVSGVRTRAKTLALQRLQKTTXXXXXXXXXCYLQ 183 MGKYMRK K++ E+A+M++A GVRTRA+ LALQRL+K YL+ Sbjct: 1 MGKYMRKVKVSSEVAIMDVAAAPL-----GVRTRARALALQRLEKQQVQQEEGCGGEYLE 55 Query: 184 LRSRRLEKKPPSLLS 228 LRSRRLEK PP + S Sbjct: 56 LRSRRLEKLPPQVAS 70 >ref|XP_002301783.1| kip-related cyclin-dependent kinase inhibitor 3 [Populus trichocarpa] gi|222843509|gb|EEE81056.1| kip-related cyclin-dependent kinase inhibitor 3 [Populus trichocarpa] Length = 223 Score = 69.3 bits (168), Expect = 3e-10 Identities = 41/72 (56%), Positives = 46/72 (63%), Gaps = 1/72 (1%) Frame = +1 Query: 4 MGKYMRKAKITGEI-AVMELATTTTTSLVSGVRTRAKTLALQRLQKTTXXXXXXXXXCYL 180 MGKYM+K+KIT ++ AVME+ SGVRTRAKT ALQ LQ CYL Sbjct: 1 MGKYMKKSKITSDVVAVMEVT--------SGVRTRAKTHALQLLQSPVSSNPDATSTCYL 52 Query: 181 QLRSRRLEKKPP 216 QLRSRRLEK PP Sbjct: 53 QLRSRRLEKPPP 64 >ref|NP_199693.1| cyclin-dependent kinase inhibitor 3 [Arabidopsis thaliana] gi|75262601|sp|Q9FKB5.1|KRP3_ARATH RecName: Full=Cyclin-dependent kinase inhibitor 3; AltName: Full=Inhibitor/interactor of CDK protein 6; AltName: Full=KIP-related protein 3 gi|9758881|dbj|BAB09435.1| unnamed protein product [Arabidopsis thaliana] gi|14422289|emb|CAC41617.1| cyclin-dependent kinase inhibitor 3 [Arabidopsis thaliana] gi|94442511|gb|ABF19043.1| At5g48820 [Arabidopsis thaliana] gi|332008345|gb|AED95728.1| cyclin-dependent kinase inhibitor 3 [Arabidopsis thaliana] Length = 222 Score = 68.9 bits (167), Expect = 4e-10 Identities = 44/76 (57%), Positives = 53/76 (69%), Gaps = 2/76 (2%) Frame = +1 Query: 4 MGKYMRKAKITGEIAVMELATTTTTSLVSGVRTR-AKTLALQRLQKT-TXXXXXXXXXCY 177 MGKYM+K+KITG+I+VME++ T S GVRTR AKTLAL+RL + CY Sbjct: 1 MGKYMKKSKITGDISVMEVSKATAPS--PGVRTRAAKTLALKRLNSSAADSALPNDSSCY 58 Query: 178 LQLRSRRLEKKPPSLL 225 LQLRSRRLE KP SL+ Sbjct: 59 LQLRSRRLE-KPSSLI 73