BLASTX nr result
ID: Coptis23_contig00024275
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00024275 (208 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003635163.1| PREDICTED: ankyrin repeat domain-containing ... 57 2e-06 ref|XP_002270437.2| PREDICTED: ankyrin repeat domain-containing ... 57 2e-06 emb|CBI24454.3| unnamed protein product [Vitis vinifera] 57 2e-06 >ref|XP_003635163.1| PREDICTED: ankyrin repeat domain-containing protein, chloroplastic isoform 2 [Vitis vinifera] Length = 406 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/54 (51%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = +2 Query: 50 IFEDPYLQKDYNFEKPSNK-KKQTVSLPPEEDLVPEKWKEAVVEYNITKKERKK 208 +FEDPYLQ +++F + K K + + PE +LVPEKWKE + NITKKER+K Sbjct: 83 VFEDPYLQDNFDFNAQNPKHNKPNLEIEPE-NLVPEKWKEVQEQINITKKERRK 135 >ref|XP_002270437.2| PREDICTED: ankyrin repeat domain-containing protein, chloroplastic isoform 1 [Vitis vinifera] Length = 439 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/54 (51%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = +2 Query: 50 IFEDPYLQKDYNFEKPSNK-KKQTVSLPPEEDLVPEKWKEAVVEYNITKKERKK 208 +FEDPYLQ +++F + K K + + PE +LVPEKWKE + NITKKER+K Sbjct: 83 VFEDPYLQDNFDFNAQNPKHNKPNLEIEPE-NLVPEKWKEVQEQINITKKERRK 135 >emb|CBI24454.3| unnamed protein product [Vitis vinifera] Length = 531 Score = 56.6 bits (135), Expect = 2e-06 Identities = 28/54 (51%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = +2 Query: 50 IFEDPYLQKDYNFEKPSNK-KKQTVSLPPEEDLVPEKWKEAVVEYNITKKERKK 208 +FEDPYLQ +++F + K K + + PE +LVPEKWKE + NITKKER+K Sbjct: 175 VFEDPYLQDNFDFNAQNPKHNKPNLEIEPE-NLVPEKWKEVQEQINITKKERRK 227