BLASTX nr result
ID: Coptis23_contig00024104
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis23_contig00024104 (988 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002513017.1| pentatricopeptide repeat-containing protein,... 72 2e-10 >ref|XP_002513017.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223548028|gb|EEF49520.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 349 Score = 72.4 bits (176), Expect = 2e-10 Identities = 45/123 (36%), Positives = 57/123 (46%), Gaps = 43/123 (34%) Frame = -3 Query: 797 RDFGIKPEDEHYSCVLDMHFEADEL*KPYKLVKDS------------------------- 693 RDF + P EHYSCV+D+ A EL + +KLV + Sbjct: 227 RDFNLTPSPEHYSCVVDLFCRAGELDRAWKLVNEMLTKGHEIHSISMWGAVLSACEEHGN 286 Query: 692 ----------------ENVG--GSLSNFYARVSMWDEIQNLRELMEEWGLMKGVGCSWIG 567 +NVG LSN YAR MWDEI +LR++M++ GL K VGCSWI Sbjct: 287 IEFGKLAAREALKLEPQNVGIYVMLSNLYARFGMWDEIDHLRKIMKDRGLKKDVGCSWIE 346 Query: 566 IAS 558 I S Sbjct: 347 ITS 349